KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0644Help
Entry
SGGB_0644         CDS       T02018                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Brite
Enzymes [BR:sgt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SGGB_0644 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAK27533
UniProt: F5WZS2
LinkDB All DBs
Position
664365..664973
Genome map
AA seq 202 aa AA seqDB search
MAIILPKLPYAYDALEPYIDTETMTIHHDKHHATYVANVNAALEKHPEIGEDLEALLADV
DSIPADIRQAVINNGGGHLNHTLFWELLSPEKQEPTAQVLAAIEEDFGSFDEFKAAFTQA
ATTRFGSGWAWLVVNENGKLEVLSTANQDTPISQGKAPILALDVWEHAYYLKYRNVRPDY
IKAFFDVINWEKVAELYSKATK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccaaaactaccttatgcatatgacgctcttgagccttatattgat
acagaaacaatgacaattcaccatgataaacatcacgctacttatgtggcaaatgtaaat
gcagcgcttgaaaaacatccagaaattggagaggatttggaagctttgttggcagatgtt
gacagtattccagcagatatccgtcaagcggtgattaataacggtggtgggcatttgaat
cacacccttttctgggaattgttatcgcctgaaaaacaagaaccaacagcgcaagtgttg
gctgcgattgaggaagattttggctcatttgacgaattcaaagctgctttcacgcaagct
gcgacaactcgctttgggtcagggtgggcttggcttgtggtgaatgaaaatggcaaactt
gaagtgctctcaacagctaatcaagacacaccaatttcacaaggaaaagcaccaattttg
gcacttgacgtttgggaacacgcttactatctcaagtatcgcaacgttcgcccagattat
atcaaagctttctttgatgttattaattgggaaaaagttgctgagctttactcaaaagca
acaaagtga

DBGET integrated database retrieval system