KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1861Help
Entry
SGGB_1861         CDS       T02018                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00220  Arginine biosynthesis
sgt00250  Alanine, aspartate and glutamate metabolism
sgt00290  Valine, leucine and isoleucine biosynthesis
sgt01100  Metabolic pathways
sgt01110  Biosynthesis of secondary metabolites
sgt01130  Biosynthesis of antibiotics
sgt01210  2-Oxocarboxylic acid metabolism
sgt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGGB_1861
   00290 Valine, leucine and isoleucine biosynthesis
    SGGB_1861
   00220 Arginine biosynthesis
    SGGB_1861
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgt01007]
    SGGB_1861
Enzymes [BR:sgt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SGGB_1861
    2.6.1.66  valine---pyruvate transaminase
     SGGB_1861
Amino acid related enzymes [BR:sgt01007]
 Aminotransferase (transaminase)
  Class I
   SGGB_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Alliinase_C Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAK28717
UniProt: F5WWR0
LinkDB All DBs
Position
complement(1910396..1911610)
Genome map
AA seq 404 aa AA seqDB search
MKIFDKSSKLEHVSYDIRGPILDEATRMIANGEKILRLNTGNPAEFGFTAPDEVIRDLIA
NARNSEAYSDSKGIFSARKAIMQYCQLKGFPHVDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYLCDEKANWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPDELLKEIVEIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKNNVKGYIEGLNMLANMRLCANVLGQHVVQTSLGGYQSVDELL
IPGGRIYEQRNFIYKAVNEVPGLSAVKPDAGLYIFPKIDREMYQIDDDEQFCLELLKQEK
VMLVPGKGFNWNEPDHFRIVYLPRVEELAEVQEKLTRVLNQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttgataaatcttcaaagctagaacacgtttcttacgacatccgtggacca
attcttgacgaagccactcgtatgattgctaatggtgaaaaaatcttgcgccttaatact
ggtaacccagccgaatttggctttacagcaccagatgaagttatccgagatttgattgcc
aatgctcgcaatagtgaagcctattcagatagtaaagggattttttctgcgcgtaaggca
attatgcaatattgtcagctaaagggattcccacatgtggatattgatgatatttatcta
ggaaatggtgtgtctgaattgatttcaatgtctcttcaggcgcttcttgatgatggcgat
gaagtcttggtgccaatgcctgactatccattgtggacagcttgtgttagcttggcgggc
ggtaatgctgttcattatctttgtgatgaaaaagctaactggtatcctgatattgatgat
atcaaatcaaaaatcacttctaacacaaaagcgattgttgtgattaaccctaataaccca
acaggcgctttataccctgatgagcttcttaaagaaattgttgaaattgctcgtcaaaat
gatttgattatctttgctgatgaaatctatgatcgcttggtaatggacggcaaaaaacac
acagcaattgctagcttagcaccagatgttttctgtgtgtcaatgaatggtttatcaaaa
tctcaccgaatctgcggtttccgtgttggttggatggtcttatcaggtcctaaaaataat
gttaaaggctatattgaagggcttaatatgttggcaaatatgcgtctttgcgccaatgtt
ttaggtcaacatgttgttcaaacatcacttggtggctaccaatcagttgatgaattgttg
attcctggtggtcgaatctatgaacaacgtaactttatctataaagctgtcaatgaagtt
ccagggctttcagctgtgaaaccagacgcaggactttacattttccctaaaattgaccgt
gaaatgtatcagattgatgatgacgaacaattctgtttggaattattgaaacaagaaaaa
gtcatgttggttccgggtaaaggattcaactggaatgagccagaccacttccgtatcgtt
tatctaccacgcgtggaagaattggcagaagttcaagaaaaattaacacgagtattaaat
caatatcgacgctaa

DBGET integrated database retrieval system