KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1901Help
Entry
SGGB_1901         CDS       T02018                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Brite
KEGG Orthology (KO) [BR:sgt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SGGB_1901 (ahpF)
Enzymes [BR:sgt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SGGB_1901 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 AlaDh_PNT_C Thi4 HI0933_like FAD_binding_3 Lycopene_cycl Glutaredoxin NAD_binding_8 FMO-like DAO NAD_Gly3P_dh_N K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAK28757
UniProt: F5WWV0
LinkDB All DBs
Position
complement(1950277..1951815)
Genome map
AA seq 512 aa AA seqDB search
MALDAEIKTQLSQYLALIESDIVFQANLGTDENSKKVRDFIDEIVSMSDKIGFEEKKLSR
TPAFRIAKKGQESGVEFAGLPLGHELTSLILALLQVSGRPPKVDEEVINRIKAIDTPLHF
ETYVSLSCHNCPDVVQAFNIMAVINPNISHTMIEGGMFQDEVKAKGIMSVPTVFHNDEIL
TSGRINIEQLLDLIAGPVSETTFADKGIFDVLVIGGGPAGNSAAIYAARKGIKTGLLAET
FGGQVMETVGIENMIGTPYIEGPALMSQVEEHTKSYDVDIMKAQKAIAIHKKDVIEVTLA
NGAILKSKTAILSLGAKWRNINVPGEVEFRNKGVTYCPHCDGPLFTDKKVAVIGGGNSGL
EAAIDLAGLASHVYILEFLPELKADKVLQDRAEAHDNITILKNVATKEILGDEQVTGLIY
TDRETDVDKTLDLEGVFVQIGLVPNTDWLKDSGIDLNNRGEIIVDNQGSTTVAGIFAAGD
CTDQAYKQIIISMGSGATAALGAFDYLIRMND
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcattagatgcagaaatcaaaacacaattgtcgcaatatcttgcattaattgaatct
gatattgtttttcaggctaatcttggaacagatgaaaattctaaaaaagtcagagatttc
attgatgaaatcgtctcaatgagtgataagattggttttgaagagaagaagcttagtcgt
acgcctgcttttcgaattgctaaaaaaggacaagaatctggtgttgaatttgccggctta
ccactgggacatgagttgacttcattgattctggcacttttacaggtttctggacgacca
ccaaaagtagatgaggaagtcatcaaccgaattaaagctattgatacccctcttcatttt
gaaacttatgtcagtcttagttgtcataattgtccggatgttgtacaagctttcaatatt
atggctgtgattaatccgaatattagccataccatgattgagggaggtatgttccaagat
gaggtcaaggctaaggggattatgtccgttccaaccgtttttcacaatgatgaaatactg
acttcaggacgtatcaacattgaacaattacttgatttgattgcaggaccagtgtcagaa
acgacatttgcagataagggaatttttgatgtcttggttattggtggcggaccggctgga
aatagcgcagctatttatgctgcacgaaaaggaatcaaaacaggcttattagccgaaacg
tttggtggacaagtgatggaaaccgtcggaattgaaaatatgattggaacaccttatata
gagggaccagcgcttatgtcccaagtagaagagcacaccaaatcatacgatgtcgatatc
atgaaagctcaaaaagcgatagctattcataaaaaggatgttatcgaagttacgctagct
aacggtgctattctaaagtctaaaacagccattctatctcttggtgccaaatggcgtaat
attaatgttccgggagaagttgaatttagaaataaaggagtcacttactgtcctcactgt
gatggaccactctttacagataaaaaagtagctgtcattggtggtggtaattcagggctt
gaagctgccattgatttagcaggacttgctagccatgtctatattcttgaatttttacca
gaattaaaagctgataaagtcttacaagatcgtgcagaagcacatgataatattactatt
ttgaaaaatgttgccacaaaagaaattttgggtgatgagcaggttacgggactaatttat
acggatagagaaactgacgtggacaaaacacttgatttagagggagtctttgttcaaatt
ggtctcgttccaaataccgactggctaaaagattctggcattgaccttaataatcgtggt
gaaattattgtggataatcaagggagtacaactgttgcaggtatttttgcagctggcgac
tgtacggatcaagcatacaagcaaattattatttctatgggaagcggagccactgcagcc
ttaggtgcatttgactaccttatcagaatgaatgattaa

DBGET integrated database retrieval system