KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_2106Help
Entry
SGGB_2106         CDS       T02018                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00040  Pentose and glucuronate interconversions
sgt00053  Ascorbate and aldarate metabolism
sgt01100  Metabolic pathways
sgt01120  Microbial metabolism in diverse environments
Module
sgt_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:sgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SGGB_2106
   00053 Ascorbate and aldarate metabolism
    SGGB_2106
Enzymes [BR:sgt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     SGGB_2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 CBM_26 NAGidase NAPRTase PRMT5_TIM
Motif
Other DBs
NCBI-ProteinID: BAK28958
UniProt: F5WXF1
LinkDB All DBs
Position
complement(2164628..2165491)
Genome map
AA seq 287 aa AA seqDB search
MARPIGIYEKATPKNFTWRERLAFAKELGFDFVEMSVDESDSRLARLDWTKKERLDVVQA
IYETGIRIPSICFSGHRRYPLGSNDPKTEATSLEMMKKCIELAQDLGVRTIQLAGYDVYY
EEKSPETRARFIKNLRKACDWAEEAQVILAIEIMDDPFINSIEKYLAVEKEIDSPYLFVY
PDTGNVSAWHNDLWSEFYNGHKSIAALHLKDTYAVTENSKGQFRDVPFGDGCVDWEAMFA
ILKKTNYNGPFLIEMWSENCATVEETKQAIQVAKDFLLPKIEKAGLR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtccaattggtatttatgaaaaggcgactcctaagaattttacatggagagaa
cgtctagcgtttgcaaaagaactcggctttgattttgttgaaatgtcggtagatgaatcg
gatagccgtttggcacgtctggattggacaaaaaaagagcgtttggacgttgttcaagct
atttacgaaacaggtattcggattccaagtatttgcttttcgggacatcgccgttatcct
cttgggtctaatgaccctaaaactgaagcaacatcgcttgaaatgatgaaaaaatgtatt
gaattagcgcaagaccttggtgtccgtactattcaattggcggggtatgatgtttattac
gaagaaaaatccccagaaacacgcgctcgttttattaaaaatctcaggaaagcttgtgat
tgggctgaagaagctcaagttattctggcgattgaaattatggatgacccttttattaat
tctattgaaaaatacttggctgtggaaaaggaaattgattcgccttatctttttgtttat
ccagatactggcaatgtatcggcttggcataatgacctttggagtgaattctacaatggt
cataagtccattgctgccttgcatttaaaagatacttatgctgtcactgaaaactccaaa
gggcagtttcgtgatgtcccatttggggacggctgtgttgattgggaggctatgtttgct
attctcaagaaaacaaactataacggtccatttttgattgaaatgtggtcggaaaattgt
gcgacagttgaggaaacaaaacaagctatccaagtcgcaaaagactttttattaccaaaa
attgagaaagcggggttacgttaa

DBGET integrated database retrieval system