KEGG   Streptomyces glaucescens: SGLAU_00985
Entry
SGLAU_00985       CDS       T03327                                 

Gene name
gacV
Definition
(GenBank) dTDP-4-keto-6-deoxy-glucose-4-aminotransferase
  KO
K20428  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00525  Acarbose and validamycin biosynthesis
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SGLAU_00985 (gacV)
Enzymes [BR:sgu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     SGLAU_00985 (gacV)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: AIR96225
UniProt: B0B0U7
LinkDB
Position
237626..238918
AA seq 430 aa
MTGLRQTQHLAREARHLAPGASEEAVHGRRVFAEGRGPVLTDLDGNQYLDFAAGTLTQSL
GHGHPEVVEALTTQARRLWNVHDSATPDRAGLLELLARLLPEQLDTYAFFSTGAEVVEAA
LRVVQATAAPGRNRIGALRHGFHGKTMGARMLVHWDIGHQAFSGNSVLGYSPYCYRCPLG
LEYPSCDVRCATLVRRHIAEKPNVSALVFEPVLGAAGVIVPPPGYWERIAGACRDGGVLL
VADEVLTGGGRTGAFLASELFGIEPDLAMLSKGTASGFPFAVLAGRAELLRRPEAATPGA
YASTYASNPLGIAAARATLEVVERDRLIDRVRVLGELMEERLRALESRFPQLGQVRGLGL
LWGLEFVTDAVGRAPAPETARAVYTTALDLGLRTSLGGHILRLAPPFTLDEALLDEGLRL
LETAVERVIA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgacaggcttacggcagacacagcacctggcacgggaggcccgccacctggcgccgggc
gcctccgaggaagccgtccacggacgccgggtcttcgccgagggacgcggtcccgttctg
accgacctggacggcaaccagtacctcgacttcgcggccgggaccctcacccagtcactg
ggccacgggcacccggaggtcgtcgaggcactcaccacccaggcccgccgcctgtggaac
gtccacgacagcgccacgccggaccgcgccggcctgctggaactgctcgccaggctgctg
cccgaacagctcgacacctacgccttcttctccaccggcgcggaggtggtcgaggccgcc
ctgcgggtcgtccaggcgaccgccgcgccgggccgcaaccggatcggcgccctgcgccac
ggcttccacggcaagaccatgggcgcccggatgctggtccactgggacatcggccaccag
gccttcagcggcaacagcgtgctgggctacagcccctactgctaccgctgtcccctgggc
ctggagtacccctcgtgcgacgtgcggtgcgcgaccctcgtgcgccggcacatcgcggag
aagcccaacgtctcggccctggtcttcgaacccgtcctcggcgcggcaggcgtcatcgtg
ccgccccccggctactgggagcggatcgccggcgcctgccgggacggcggcgtgctgctc
gtcgccgacgaggtcctcaccggcggcgggcgcaccggcgccttcctcgccagcgaactg
ttcggcatcgagccggacctggcgatgctgtccaagggcaccgcgagcggattccccttc
gccgtgctggccggacgcgcggagctgctgcgcaggccggaggcggccaccccgggggcg
tacgcctcgacgtacgcgagcaacccactggggatcgccgccgcccgcgccacgctggag
gtcgtcgagcgcgaccggctgatcgaccgcgtgcgcgtcctcggcgagctcatggaggag
cggctgcgcgccctggagtcccgcttcccccagctcggccaggtacgcggcctcggactg
ctgtggggcctggagttcgtcaccgacgccgtcggccgggcacccgcccccgagaccgcc
cgggccgtctacaccaccgccctcgacctggggctgcgcacctccctgggcggccacatc
ctgcggctggcaccgccgttcaccctcgacgaggcgctgctcgacgagggcctgcgcctg
ctggagacggccgtcgagcgggtgatcgcgtga

DBGET integrated database retrieval system