KEGG   Streptomyces glaucescens: SGLAU_01015
Entry
SGLAU_01015       CDS       T03327                                 

Gene name
gacR
Definition
(GenBank) putative 1-epi-valienol-1,7-bisphosphate-1-adenylyltransferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00525  Acarbose and validamycin biosynthesis
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SGLAU_01015 (gacR)
Enzymes [BR:sgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     SGLAU_01015 (gacR)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: AIR96231
UniProt: B0B0U1
LinkDB
Position
245118..246251
AA seq 377 aa
MAEPSGVRAVLLAGGEGRRMGPLGAGRLKPLVPYGGVCRLIDFSLANARASGLGEVLLLS
QYEERQLMDDLHRVWNRADGFRVHFGPYDDAYRSAGDALPRELPERTWPAERGTADALIR
KAGHVFGGDREQVLVLHADHVYRFDYRPLIREHRASGAALTIAYQRIERRWVHLFGMVRF
NRAGRLTEFVEKPAEPTSDLVFAAFCVFDAAVLHRYLEKLDGTDWQHDISRDVIPAMLAG
GEDIRGHEVVGHWEDIGTVERYHRAHLMLAAGGPRAALPVERMPRTVRPRVDRGWVADSL
GVVASLVPADLVNEGRVEHSVLFPGVRVGEGARVRRSVLLPGATVSPGQDIDSAVVLENG
HVQRVEDTAAVTEGTRT
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggctgagccgtcgggagtgcgcgcggtcctgctggcgggcggcgaggggcggcgcatg
ggcccgctgggcgcgggacggctgaagccgctcgtcccgtacggcggtgtctgccggctg
atcgacttcagtctggccaacgcgcgcgcctcggggctgggggaggtgctgctgctgtcc
cagtacgaggagcggcagttgatggacgacctgcaccgggtgtggaaccgggcggacggc
ttccgggtccacttcgggccgtacgacgacgcctaccggtcggcgggggacgcgctcccc
cgcgagctgcccgaacgcacctggcccgccgagcgcggcaccgcggacgccctgatccgc
aaggccgggcacgtcttcggcggtgaccgcgaacaggtcctggtcctgcacgccgaccac
gtgtaccgcttcgactaccggccgctgatcagggagcaccgggcctcaggggccgctctg
acgatcgcctaccagcggatcgaacggcgctgggtgcacctgttcggaatggtccgcttc
aaccgggcgggacggctcaccgagttcgtcgagaagcccgccgaaccgaccagcgacctg
gtcttcgccgcgttctgcgtcttcgacgccgcggtgctgcaccgctacctggagaagctg
gacggcacggactggcagcacgacatcagccgggacgtcatccccgcgatgctcgcgggc
ggtgaggacatccgcggccacgaggtcgtcggccactgggaggacatcggcaccgtcgag
cgctaccaccgcgcccacctgatgctcgcggccggcgggccgcgcgccgccctcccggtc
gaacggatgcccaggacggtgcggccccgggtggaccgcggctgggtggccgactccctg
ggcgtggtcgcctcgttggtcccggcggacctcgtcaacgaaggccgggtggagcacagc
gtgctgttcccgggtgtgcgcgtcggggagggcgcacgggtccggcgcagcgtgctgctg
cccggcgccacggtctcccccggtcaggacatcgactcggcggtggtcctggagaacgga
cacgtgcagcgggtcgaggacaccgcggccgtcacggaaggaacccgtacatga

DBGET integrated database retrieval system