KEGG   Streptomyces glaucescens: SGLAU_01235
Entry
SGLAU_01235       CDS       T03327                                 

Gene name
stsC
Definition
(GenBank) L-glutamine:scyllo-inosose aminotransferase, StsC
  KO
K05957  L-glutamine:scyllo-inosose aminotransferase [EC:2.6.1.50]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00521  Streptomycin biosynthesis
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGLAU_01235 (stsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgu01007]
    SGLAU_01235 (stsC)
Enzymes [BR:sgu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.50  glutamine---scyllo-inositol transaminase
     SGLAU_01235 (stsC)
Amino acid related enzymes [BR:sgu01007]
 Aminotransferase (transaminase)
  Others
   SGLAU_01235 (stsC)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase ptaRNA1_toxin
Other DBs
NCBI-ProteinID: AIR96275
UniProt: A0A089YRJ9
LinkDB
Position
305062..306336
AA seq 424 aa
MGNSLAISGGPRLVDREWPRWPQPGDRALKSLEDVLTSGRWTISCAYQGRQSYERQFAEA
FAEYCNSPLCVPVATGTAALAIALEACGVGASDEVVVPGLSWVASSSAVLGINAVPVLVD
VDPETYCLDPAAVEAAITDRTRAITVVHAYSAVADLDALLDIAQRYGLPLVEDCAHAHGA
RYSNWPVGAFGTAGAFSMQGSKLLTCGEGGAVITDDPEIASRAEHLRADGRMLRRDAVDV
GEMELMETGRLMGSNACLSEFHAAVLLDQLDLLDQQNARRSRSAERLSVRLAELGLTPQS
TSAGTTERAYYRYAVRLPDEVLAVAPVDRIAQALGAELGFPVMRTHQPLNDNPLNRPSTR
RRFAIDREYMTRIDPARFDLPVARRVHDSVVSFGHEVLLAPLDAIDDIAEAFAKVLSHVG
ELAV
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggaaattcgctggcaatctccggtgggcctcggctggtcgaccgggagtggccgcgc
tggccgcaaccgggagaccgggcactgaaaagtctcgaagacgtgttgacgagcggtcgc
tggaccatcagttgcgcctatcagggacggcaatcctacgagcgacaattcgcggaggca
ttcgcggagtactgcaattcccccctgtgcgtgccggtggcgacggggacggccgcgctg
gccatcgccctggaggcctgcggagtcggcgcgtcggacgaggtggtggtgcccggtctg
agctgggtggcctcctcgtcggcggtgctggggatcaacgccgtgccggtcctggtcgac
gtcgacccggagacgtactgcctggacccggcggcggtggaggccgccatcaccgaccgg
acgcgcgccatcaccgtggtccacgcctattcggccgtggcggacctcgacgccctgctg
gacatcgcccagcgctacggcctgccgctggtcgaggactgcgcgcacgcgcacggtgcc
cggtacagcaactggccggtgggggcgttcggcacggcgggcgccttcagcatgcagggc
agcaagctgctgacgtgcggtgagggcggcgccgtgatcacggacgatcccgagatcgcg
agccgtgcggagcatctgcgcgcggacggccgcatgctgcggcgggacgccgtggacgtg
ggcgagatggaactgatggagacgggccggctgatgggcagcaacgcctgcctgtccgag
ttccacgcggcggtgctgctggaccagctcgacctgctcgaccagcagaacgcacgccgc
agcaggtcggccgagcggctgtccgtccggctggccgagctggggctcacgccgcagagc
acctcggccgggacgaccgagcgggcctactaccgctatgcggtgcggctcccggacgag
gtgctggccgtcgccccggtggaccggatcgcccaggcgctcggcgcggagctgggcttc
ccggtcatgcggacgcaccagccgctcaacgacaatccgctgaaccggccgagcacccgg
cgcaggttcgcgatcgaccgcgagtacatgacacggatcgacccggcccgcttcgacctg
ccggtcgcccggcgcgtccacgacagcgtggtgagcttcggccacgaggtgctgctggct
ccgctcgacgcgatcgacgacatagcggaggcgttcgcgaaggtcctgtcacacgtgggg
gaactggccgtctga

DBGET integrated database retrieval system