KEGG   Streptomyces glaucescens: SGLAU_03345Help
Entry
SGLAU_03345       CDS       T03327                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SGLAU_03345
Enzymes [BR:sgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SGLAU_03345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4159 DUF4434 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AIR96697
UniProt: A0A089WZ00
LinkDB All DBs
Position
complement(762145..764169)
Genome map
AA seq 674 aa AA seqDB search
MPETTPKGLTRLAFGGDYNPEQWPESVWQEDVRLMREAGVSMVSVGIFSWALLEPAPGAY
DFGWLDRLLDLLHANGVRVDLGTPTVVPPVWFYREHPEALPVTADGTRYEFGSRGAICHS
NADYRAAAARITTELARRYGDHPALAMWHVHNEYGVPVSACYCDSCAAHFRRWLADAYGT
VDAVNEAWGTAFWGQRYTGLEQINPPRVTPTAGNPAQALDYKRFADATIRENFVAERDIL
HRLSPGVPVTTNFMTALSQCDSLDYWAWGREVDLVTNDHYLITDGRRTHVNLAMAADLTR
SVAGGAPWLLLEHSTSGVNWQARNPAKAPGQMARNSLAHVARGSEGAMFFQWRQSRRGAE
KFHSAMVPHGGTDTRVWREVVELGASLGALHEIRGTRTRPDVAVLWDWHSWWAQNLEWRP
SEDHDARERADSFYEALYDRHLTVDFAHPEADLSAYPLVVVPALYLMTEAAGRNLRTYVE
NGGTLLVSYFSGIVDEHDAVHEGAHPGALRDVLGLTVEEFSPLLEGESVRVTGPGGVPDL
AADVWTEFVVPRGAETVWSYADGLTAGRPAVTRHRLGEGTAWYVSTRLAADGLDAVLARA
AEDAGLPPRTGLPRDVEVVLRTGESGTYLFALNHTGTDAEVPLETPGTELLTGERAAGGV
EVPAGAVRVVRLDG
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaccacccccaagggcctcacgaggctcgccttcggtggggactacaacccc
gagcagtggccggaaagcgtctggcaggaggacgtccggctgatgcgggaggccggcgtc
tccatggtgagtgtcgggatcttctcctgggcgctgctggagcccgcgcccggcgcgtac
gacttcggctggctcgaccggctgctggacctgctgcacgcgaacggcgtccgcgtggac
ctcggcacccccaccgtggtgcccccggtctggttctaccgcgagcaccccgaggcgctg
ccggtgaccgccgacggcacccgctacgagttcggctcacgcggcgccatctgccacagc
aacgccgactaccgggccgccgccgcgcgcatcaccaccgagctggcccggcgctacggc
gaccaccccgccctcgcgatgtggcacgtccacaacgagtacggcgtcccggtctccgcc
tgttactgcgactcctgcgccgcccacttccgccgctggctggcggacgcctacggcacg
gtcgacgcggtcaacgaggcctggggcaccgccttctggggccagcgctacaccggcctg
gagcagatcaacccgccgcgcgtcacccccaccgccggcaatcccgcgcaggccctggac
tacaagcggttcgccgacgccacgatccgcgagaacttcgtggccgagcgggacatcctg
caccgcctgtcgcccggcgtcccggtgaccaccaacttcatgaccgcgctcagccagtgc
gactccctcgactactgggcctggggccgcgaggtcgacctcgtcaccaacgaccactac
ctcatcaccgacggccgccgcacccacgtcaacctggccatggccgccgacctcacccgc
tcggtggcgggcggcgccccctggctgctcctggagcactccacctcgggcgtgaactgg
caggcccgcaaccccgccaaggcgcccggccagatggcccgcaactcgctcgcccacgtg
gcgcgcggttccgagggcgccatgttcttccagtggcggcagtcccggcgcggcgccgag
aagttccactcggccatggtcccgcacggcggaaccgacacccgggtctggcgggaggtc
gtcgaactgggcgcgtcgctcggcgcgttgcacgagatccgtggcacccgcacccgccct
gacgtggcggtgctctgggactggcactcctggtgggcgcagaacctcgaatggcggccc
agcgaggaccacgacgcccgtgagcgggccgacagcttctacgaggcgctctacgaccgc
cacctcacggtcgacttcgcccacccggaagccgacctgtccgcctacccgctggtcgtg
gtgcccgcgctgtacctgatgaccgaggcggccgggcgcaatctccggacgtacgtcgag
aacggcggcaccctgctggtgtcctacttctccggcatcgtcgacgagcacgacgccgtc
cacgagggcgcccacccgggcgcgctgcgcgacgtcctcggcctgaccgtcgaggagttc
tccccgctgctggagggcgagtcggtccgcgtcaccggccccggcggcgtccccgacctg
gccgccgacgtgtggacggagttcgtggtgccgcgcggtgccgagaccgtgtggagctac
gccgacggcctcaccgccggccgccccgcggtcacccggcaccgcctgggcgagggcacc
gcctggtacgtctccacccggctcgccgccgacggcctcgacgcggtgctcgcccgggcc
gccgaggacgcgggcctccccccgcgcaccgggctgccccgcgacgtcgaagtggtgctg
cgcaccggcgagtcgggcacctacctgttcgccctcaaccacaccggcaccgacgccgag
gtgccgctggagacgcccggcaccgagctgctcaccggcgaacgcgccgcgggcggtgtc
gaggtacccgcgggagccgtgcgggtcgtccggctcgacggctga

DBGET integrated database retrieval system