KEGG   Streptomyces glaucescens: SGLAU_18730Help
Entry
SGLAU_18730       CDS       T03327                                 

Definition
(GenBank) Putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00010  Glycolysis / Gluconeogenesis
sgu00053  Ascorbate and aldarate metabolism
sgu00071  Fatty acid degradation
sgu00280  Valine, leucine and isoleucine degradation
sgu00310  Lysine degradation
sgu00330  Arginine and proline metabolism
sgu00340  Histidine metabolism
sgu00380  Tryptophan metabolism
sgu00410  beta-Alanine metabolism
sgu00561  Glycerolipid metabolism
sgu00620  Pyruvate metabolism
sgu00625  Chloroalkane and chloroalkene degradation
sgu00903  Limonene and pinene degradation
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
Module
sgu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGLAU_18730
   00053 Ascorbate and aldarate metabolism
    SGLAU_18730
   00620 Pyruvate metabolism
    SGLAU_18730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGLAU_18730
   00561 Glycerolipid metabolism
    SGLAU_18730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGLAU_18730
   00310 Lysine degradation
    SGLAU_18730
   00330 Arginine and proline metabolism
    SGLAU_18730
   00340 Histidine metabolism
    SGLAU_18730
   00380 Tryptophan metabolism
    SGLAU_18730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGLAU_18730
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGLAU_18730
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGLAU_18730
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SGLAU_18730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AIR99706
UniProt: A0A089XCQ3
LinkDB All DBs
Position
4275552..4277012
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLAQQYIDGEWRPGTGSWDIIDFNPYDSEKLASITIATADEIDQAYRAAERAQR
DWARAGAFARRAVLEKALRLVEEREAEIGDAIVAELGGTRVKAAFELHLAKEFLREAAAL
ATRPEHRLIPSPDPAKENRLHRVPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPH
QDTPVTGGTLVARIFEDAGLPAGALNVVVTDIAEIGDAFIEHPVPKVISFTGSDAVGRHV
ATVCAARFKRAVLELGGNSALVVLDDADLDYAVDAAVFSRYVHQGQVCMAANRVLVDRSV
ADEFTEKFVAKVRSLKVGDPRDPQTVIGPVINSSQAESLSGAVEQAVAEGATALLRGTVR
DNLVEPSVLTDVPAGSPILRQELFGPVALLIPFDDEEEAVRLVNDTPYGLSGAVHTGDVQ
RGVRFAERVDTGMFHVNDGTVHDEPLVPFGGEKHSGVGRLNGESTLDAFTTLKWISVQHG
RSRFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctacttcaccgacctggcccagcagtacatcgacggcgagtggcggcccgga
accggctcctgggacatcatcgacttcaatccgtacgacagcgagaagctggcctcgatc
accatagccaccgccgacgagatagatcaggcataccgggccgccgaacgcgcccagcgg
gactgggcccgcgcgggcgccttcgcccgccgcgcggtgctggagaaggcgctgcggctg
gtcgaggaacgtgaggcggagatcggcgacgcgatcgtcgccgagctgggcggcacccgc
gtgaaggccgccttcgaactgcacctcgccaaggagttcctgcgcgaggccgccgcgctc
gccacgcgccccgagcaccggctgatcccctcgcccgaccccgccaaggagaaccgcctg
caccgcgtaccggtcggcgtcgtcggggtcatcagccccttcaacttccccttcctgctg
tcgctgaagtccgtggcgcccgccctggcgctcggcaacgccgtggtcctcaagccgcac
caggacaccccggtcaccggcggcaccctggtcgccaggatcttcgaggacgcgggcctc
ccggccggtgcgctgaacgtcgtggtcaccgacatagccgagatcggcgacgccttcatc
gagcacccggtgcccaaggtcatctccttcaccggctccgacgcggtcggccggcacgtc
gccaccgtctgcgccgcgcggttcaagcgggccgtcctggagctgggcggcaacagcgcg
ctggtcgtcctcgacgacgccgacctcgactacgcggtcgacgcggccgtcttcagccgc
tacgtccaccagggccaggtctgcatggccgccaaccgcgtcctcgtggaccgctcggtc
gcggacgagttcaccgagaagttcgtcgccaaggtcaggtccctgaaggtgggcgacccg
cgcgacccgcagaccgtcatcggcccggtcatcaactcctcccaggccgagtcgctgtcc
ggcgcggtggagcaggcggtcgccgagggcgccacggccctgctgcgcggcacggtgcgc
gacaacctggtcgagccgtccgtgctgaccgacgtgcccgcgggctccccgatcctgcgc
caggagctcttcggcccggtcgccctgctcatcccgttcgacgacgaggaggaggccgta
cgcctggtcaacgacaccccgtacggcctcagcggcgccgtccacaccggtgacgtgcag
cgcggcgtccgcttcgccgagcgcgtcgacaccggcatgttccacgtcaacgacggcacc
gtccacgacgagcccctcgtccccttcggcggcgagaagcactccggtgtgggccggctg
aacggcgagtcgaccctcgacgccttcaccaccctgaagtggatctcggtgcagcacggg
cgcagcaggttccccttctga

DBGET integrated database retrieval system