KEGG   Streptomyces glaucescens: SGLAU_20745Help
Entry
SGLAU_20745       CDS       T03327                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00020  Citrate cycle (TCA cycle)
sgu00270  Cysteine and methionine metabolism
sgu00620  Pyruvate metabolism
sgu00630  Glyoxylate and dicarboxylate metabolism
sgu00680  Methane metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
sgu01200  Carbon metabolism
Module
sgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sgu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sgu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGLAU_20745 (mdh)
   00620 Pyruvate metabolism
    SGLAU_20745 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    SGLAU_20745 (mdh)
  Energy metabolism
   00680 Methane metabolism
    SGLAU_20745 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SGLAU_20745 (mdh)
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SGLAU_20745 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AIS00103
UniProt: A0A089X848
LinkDB All DBs
Position
4717958..4718947
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVRLRLLEITPALKAAEGTAMELDD
CAFPLLQGIDITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGQAINAH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVSDIK
RLTIWGNHSATQYPDIFHATIGGKNAAEVVNDEQWLADDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYSWVNGTPEGDWVSMGIPSDGSYGVPEGLISSFPVTCKDGKYEIVQGLE
INEFSRTRIDASVQELAEEREAVRALGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtccgcctgcgc
ctcctggagatcaccccggccctcaaggccgccgagggcaccgcgatggagctggacgac
tgcgcgttcccgctgctccagggcatcgacatcaccgacgacccgaacgtggccttcgac
ggcgccaacgtcgccctcctggtgggcgcccgcccgcgcaccaagggcatggagcgcggt
gacctgctggaggccaacggcggcatcttcaagccgcagggccaggccatcaacgcccac
gccgcggacgacatcaaggtcctcgtcgtcggcaacccggccaacaccaacgccctcatc
gcgcaggccgccgccccggacgtacccgccgagcgcttcaccgcgatgacccgcctggac
cacaaccgcgcgctgacccagctcgcgaagaagacgggttcgacggtctccgacatcaag
cgcctgacgatctggggcaaccactccgccacccagtacccggacatcttccacgccacc
atcggcggcaagaacgccgccgaggtcgtcaacgacgagcagtggctggccgacgacttc
atcccgaccgtcgccaagcgaggcgccgccatcatcgaggcccgcggtgcctcgtcggcc
gcctccgccgccaacgccgccatcgaccacgtctactcctgggtcaacggcaccccggag
ggcgactgggtctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttccccgtcacctgcaaggacggcaagtacgagatcgtgcagggcctggag
atcaacgagttctcccgcacccgcatcgacgcctccgtccaggagctggcggaggagcgc
gaggcggtccgcgccctcggcctgatctga

DBGET integrated database retrieval system