KEGG   Streptomyces glaucescens: SGLAU_20895Help
Entry
SGLAU_20895       CDS       T03327                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00020  Citrate cycle (TCA cycle)
sgu00190  Oxidative phosphorylation
sgu00650  Butanoate metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
sgu01200  Carbon metabolism
Module
sgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sgu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGLAU_20895 (sdhB)
   00650 Butanoate metabolism
    SGLAU_20895 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SGLAU_20895 (sdhB)
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SGLAU_20895 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SGLAU_20895 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_16 Fer4 Fer4_18 Fer4_4 Fer4_6 Fer4_2 Fer4_15 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AIS00133
UniProt: A0A089X871
LinkDB All DBs
Position
complement(4748124..4748885)
Genome map
AA seq 253 aa AA seqDB search
MATPVLDKVGADSAASPYITVTFRVRRFNPEISAEATWEDFQLEIDPKERVLDGLHKIKW
DLDGTLTFRRSCAHGICGSDAMRINGKNRLACKTLIKDINPEKPITVEPIKGLTVLKDLV
VDMEPFFQAYRDVMPFLITKDTNEPTRERLQSAEDRERFDDTTKCILCAACTTSCPVFWN
DGQYFGPAAIVNAHRFIFDSRDEAGEQRLEILNDKDGVWRCRTTFNCTDACPRGIEVTKA
IQEVKRALITRRY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctacccctgttctggacaaggtcggggcggactccgccgcctccccgtacatcacc
gtcaccttccgggtccgccggttcaacccggagatctcggcggaggcgacctgggaagac
tttcagctggagatcgaccccaaggagcgcgtcctcgacgggctgcacaagatcaagtgg
gacctggacggcacgctgaccttccgccgctcctgcgcccacggcatctgcggctcggac
gccatgcggatcaacggcaagaaccgtctggcctgcaagacgctgatcaaggacatcaac
ccggagaagccgatcacggtcgagcccataaagggcctgacggtcctgaaggacctggtc
gtcgacatggagccgttcttccaggcgtaccgggacgtgatgcccttcctgatcacgaag
gacaccaacgagccgacccgtgagcggctccagtcggccgaggaccgcgagcgcttcgac
gacaccacgaagtgcatcctgtgcgccgcctgcaccacctcgtgcccggtgttctggaac
gacggccagtacttcggcccggccgccatcgtcaacgcgcaccgcttcatcttcgactcg
cgtgacgaggcgggcgagcagcgcctggagatcctcaacgacaaggacggcgtctggcgc
tgccgcacgacgttcaactgcacggacgcctgcccgcgcggtatcgaggtcaccaaggcg
atccaggaagtgaagcgggcgctgatcacgcgccgctactga

DBGET integrated database retrieval system