KEGG   Streptomyces glaucescens: SGLAU_20900Help
Entry
SGLAU_20900       CDS       T03327                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00020  Citrate cycle (TCA cycle)
sgu00190  Oxidative phosphorylation
sgu00650  Butanoate metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
sgu01200  Carbon metabolism
Module
sgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sgu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGLAU_20900 (sdhA)
   00650 Butanoate metabolism
    SGLAU_20900 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SGLAU_20900 (sdhA)
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SGLAU_20900 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SGLAU_20900 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like DAO Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AIS00134
UniProt: A0A089XA72
LinkDB All DBs
Position
complement(4748885..4750639)
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIESTKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEILAKEAIDSVLDLEKMGLPFNRTPNGTIDQRRFGGHS
RNHGEAPVRRSCYAADRTGHMILQTLYQNCVKHGVEFFNEFYVLDQLITEVGGVKKSAGV
VAYELATGEIHVFQAKSVIYASGGCGKFFKVTSNAHTLTGDGQAAVYRRGIPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVEGEVLADNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGKRAGIAAAEYSQK
ADFVELPENPEAFVVEQIERLRSSTGNERVAELRRELQETMDANVMVFRTEQTIKTAVEK
IAELRERYKNVAIQDKGKRFNTDLLEAIELGNLLDLAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGADGSETVRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcgtcggcgccggtggcgccggtatgcgcgcg
gccatcgagtcgacgaagcgcagccgcaccgccgtgctcaccaagctctaccccacccgc
tcccacacgggcgccgcgcagggcggcatggccgccgcgctggccaacgtggaggaggac
aactgggagtggcacaccttcgacacggtcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctcgcgaaggaggccatcgactccgtcctcgacctggagaagatgggc
ctgccgttcaaccggaccccgaacggcaccatcgaccagcgccgcttcggcggtcacagc
cgcaaccacggcgaggccccggtccgccggtcctgctacgcggccgaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaagcacggcgtggagttcttcaacgag
ttctacgtcctggaccagctgatcaccgaggtgggcggcgtcaagaagtccgccggtgtc
gtcgcgtacgagctggcgaccggtgagatccacgtcttccaggcgaagtccgtgatctac
gcctccggcggctgcggcaagttcttcaaggtgacctccaacgcgcacacgctgaccggt
gacggccaggcggccgtgtaccggcggggcatcccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcgcatgggcatcctgctgacggagggcgcccgcggtgag
ggcggcatcctccgcaacaaggacggcgagcgcttcatggagaagtacgcgcccgtcatg
aaggacctggcgtcccgtgacgtcgtgtcccgctccatctacaccgagatccgggagggc
cgcggctgcggtcccgagggcgaccacgtctacctggacctcacccacctgccgccggag
cagctggacgccaagctcccggacatcaccgagttcgcgcggacctacctgggcatcgag
ccgtacacggacccgatcccgatccagccgaccgcgcactacgccatgggcggtatcccg
accaacgtcgagggtgaggtcctggcggacaacaccaccgtcgtcccgggcctgtacgcg
gccggcgaggtcgcctgcgtctcggtgcacggcgccaaccgcctgggcaccaactcgctg
ctggacatcaacgtgttcggcaagcgggccggcatcgcggcggcggagtactcgcagaag
gcggacttcgtcgagctgccggagaacccggaggcgttcgtcgtcgagcagatcgagcgg
ctgcgcagctccaccggcaacgagcgggtggccgagctgcgccgcgagctgcaggagacc
atggacgccaacgtcatggtgttccgcaccgagcagacgatcaagacggcggtcgagaag
atcgccgagctgcgcgagcgctacaagaacgtggcgatccaggacaagggcaagcggttc
aacacggacctgctggaggccatcgagctgggcaacctgctcgacctggccgaggtcatg
gcggtctccgccctggcccgcaaggagtcccgcggcggtcactaccgcgaggactacccg
aaccgtgacgacgtcaacttcatgcgccacaccatggcgtaccgcgaggtcggcgccgac
gggtccgaaaccgtccgtctcgactacaagccggtcgtccagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system