KEGG   Streptomyces glaucescens: SGLAU_22865Help
Entry
SGLAU_22865       CDS       T03327                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SGLAU_22865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sgu03400]
    SGLAU_22865
Enzymes [BR:sgu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SGLAU_22865
DNA repair and recombination proteins [BR:sgu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SGLAU_22865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIS00523
UniProt: A0A089X998
LinkDB All DBs
Position
complement(5182463..5183335)
Genome map
AA seq 290 aa AA seqDB search
MTVVEGRKLALSNLEKVLYPASGFTKGEMLHYYATAAEVLLPHLRDRPVSFLRYPDGPDG
QLFFTKNVPPGTPDWVMTAEVPRSEGPARMVLVQDLPSLMWAANQVAEFHTHQWLAGSPE
EADRIVFDLDPGPPATVVHCCEVALWLRERLAADGIEAYAKTSGSKGLHLLAAVRGAPSE
RTSEYAKALAVEAERAMPRLVVHRMTRSLRPGKVFVDWSQNAARKTTATPYTLRARAEPW
VSAPVTWEEVEACGDPAQLAFRAPDIAPRVQDYGDLLAPLLDPERVAALP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggtggagggccggaagctcgcgctgagcaacctggagaaggtgctgtacccg
gcgtccgggttcacgaagggcgagatgctgcactactacgccaccgccgccgaggtcctg
ctcccccatctgcgggaccggccggtgtccttcctgcggtatccggacgggcccgacggg
cagctcttcttcaccaagaacgtgccgccgggtacgcccgactgggtcatgaccgccgag
gtgccccgctccgagggtccggcgcggatggtgctggtgcaggacctgccgagcctcatg
tgggcggcgaaccaggtcgccgagttccacacccaccagtggctcgcgggcagccccgag
gaggccgaccggatcgtcttcgacctggacccgggtccgccggcgaccgtcgtgcactgc
tgcgaggtcgccctgtggctgcgggagcggctggccgcggacgggatcgaggcgtacgcc
aagacgtcgggctccaaggggctgcacctgctggcggcggtgcggggagcgccctccgag
cggacgtccgagtacgccaaggcgctcgccgtcgaggcggagcgggcgatgccccggctg
gtcgtgcaccgcatgacgcggagtctgcgcccgggcaaggtgttcgtcgactggagccag
aacgccgcccgcaagacgacggcgaccccgtacaccctgcgggcgcgcgccgagccgtgg
gtgtccgcccccgtgacctgggaggaggtcgaggcgtgcggcgatccggcgcagctcgcg
ttccgggcgcccgacatcgccccgcgcgtgcaggactacggcgacctgctggccccgctg
ctggatccggagcgggtggccgcgctgccgtga

DBGET integrated database retrieval system