KEGG   Streptomyces glaucescens: SGLAU_26340
Entry
SGLAU_26340       CDS       T03327                                 

Gene name
tcmH
Definition
(GenBank) Tetracenomycin polyketide synthesis hydroxylase TcmH
  KO
K15969  tetracenomycin F1 monooxygenase [EC:1.13.12.21]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu01057  Biosynthesis of type II polyketide products
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Module
sgu_M00783  Tetracenomycin C/8-demethyltetracenomycin C biosynthesis, tetracenomycin F2 => tetracenomycin C/8-demethyltetracenomycin C
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SGLAU_26340 (tcmH)
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.21  tetracenomycin-F1 monooxygenase
     SGLAU_26340 (tcmH)
SSDB
Motif
Pfam: ABM
Other DBs
NCBI-ProteinID: AIS01206
UniProt: A0A089Z5Z1
LinkDB
Position
6010921..6011259
AA seq 112 aa
MATISPSPDLFTLVNVFGVAPEKQRELRDHLVQVTEDLIRHMPGFVSATFHLSRDGEQVV
NYAQWRSEADFRAMHADPRLQPHFDYCRSVSRPKPIFCEVTHSFGATSPEGA
NT seq 339 nt   +upstreamnt  +downstreamnt
atggcgaccatctccccctcgccggacctgttcaccctcgtcaacgtcttcggcgtcgcc
cccgagaagcagcgggaactgcgcgaccacctggtgcaggtgaccgaggacctgatccgg
cacatgccgggtttcgtctccgcgaccttccacctcagccgcgacggcgaacaggtcgtc
aactacgcacagtggcggtcggaggccgacttccgcgccatgcacgccgacccgcggctg
cagccccacttcgactactgccggtccgtgtcccggccgaagccgatcttctgcgaggtc
acccactccttcggcgccacgtcaccggagggagcgtga

DBGET integrated database retrieval system