KEGG   Streptomyces glaucescens: SGLAU_27090Help
Entry
SGLAU_27090       CDS       T03327                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00250  Alanine, aspartate and glutamate metabolism
sgu00410  beta-Alanine metabolism
sgu00640  Propanoate metabolism
sgu00650  Butanoate metabolism
sgu01100  Metabolic pathways
sgu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGLAU_27090
   00650 Butanoate metabolism
    SGLAU_27090
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGLAU_27090
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGLAU_27090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgu01007]
    SGLAU_27090
Enzymes [BR:sgu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SGLAU_27090
Amino acid related enzymes [BR:sgu01007]
 Aminotransferase (transaminase)
  Class III
   SGLAU_27090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIS01356
UniProt: A0A089Z6F4
LinkDB All DBs
Position
6186372..6187658
Genome map
AA seq 428 aa AA seqDB search
MTDDLWGRHRSVLPDWLALYYDRPLEITHGEGRHVWDAAGNRYLDFFGGILTTMTAHALP
EVTKAVAEQAGRIVHSSTLYLNRPMVELAERVAQLSGIPDARVFFTTSGTEANDTALLLA
TTYRRSNTVLAMRNSYHGRSFSAVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYAALDD
RAFIDACVEDLRDLLGHTRPPAALIAEPVQGVGGFTSPPDGLYAAFREVLHERGALWIAD
EVQTGWGRTGEHFWGWQAHGRSGPPDIVTFAKGIGNGMSVGGVIARSEIMNCLDANSIST
FGGTQITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAAAAQVPAVREVRGRGLMIGI
ELTRPGTDEAAPEAAAAVLEAAREGGLLIGKGGGHSTSALRIAPPLSLTVAEAEEGAEIL
EGALRSIA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgacctgtggggacggcaccggtccgtcctgcccgactggctcgccctctac
tacgaccgcccgctggagatcacccacggcgagggccggcacgtctgggacgccgcgggc
aaccgctacctcgacttcttcggcggcatcctgaccacgatgaccgcgcacgcgctgccc
gaggtgaccaaggcggtcgccgagcaggccgggcggatcgtccactcgtccaccctctac
ctcaaccggcccatggtggagctcgcggaacgcgtcgcccagctgagcggcatcccggac
gcccgggtcttcttcaccacctcgggcaccgaggccaacgacaccgcactgctgctcgcc
accacctaccggcgcagcaacaccgtgctggccatgcgcaacagctaccacggccgctcc
ttctccgccgtgggcatcaccggcaaccgcggctggtccccgacctccctgtccccgctc
cagacgctgtacgtgcacggcggggtccgcacccgcggcccgtacgccgcgctcgacgac
cgcgcgttcatcgacgcctgcgtcgaggacctgcgggacctgctcggccacacccgcccg
cccgccgcgctgatcgccgagcccgtccagggcgtgggcggcttcacctccccgccggac
ggcctgtacgcggcgttccgcgaggtgctgcacgagcgcggcgcgctgtggatcgccgac
gaggtgcagaccgggtggggccgtaccggcgagcacttctggggctggcaggcgcacggc
cgtagtggcccgccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccgtc
ggcggcgtcatcgcccgctccgagatcatgaactgcctggacgccaacagcatctccacg
ttcggcggcacccagatcaccatggccgcgggtctcgccaacctgacgtacctgctggaa
cacgacctccagggcaacgcccggcgggtcggcggactgctcatcgaacgcctgcgggcc
gccgccgcgcaggtcccggccgtacgggaggtgcgcgggcgcggactgatgatcggcatc
gagctgacgaggcccggcaccgacgaggcggcgcccgaggccgcggcggccgtgctggag
gcggcccgcgagggcggcctgctcatcggcaagggcggcgggcacagcacgagcgccctg
cggatcgccccgccgctgtccctcacggtcgccgaggccgaggagggcgccgagatcctc
gaaggcgccctgcggagcatcgcctag

DBGET integrated database retrieval system