KEGG   Streptomyces glaucescens: SGLAU_27360Help
Entry
SGLAU_27360       CDS       T03327                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sgu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SGLAU_27360
Enzymes [BR:sgu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SGLAU_27360
DNA repair and recombination proteins [BR:sgu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SGLAU_27360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIS01410
UniProt: A0A089XJS0
LinkDB All DBs
Position
6249869..6250795
Genome map
AA seq 308 aa AA seqDB search
MSGAQTRTVRAGRRTVEVRRPGKVLFPAGDGHPEYTKGDLVDYYRSVAPFLLPHVRGRPL
MLEMHPDGVDGPAFMQKNTPDGYPDWITRVEVPKEGGTVRHTVCDDSATLVHLAGQACVT
LHRWLSRGDRPDHPDRMVFDLDPSGDDFAPVRETAVLLGELLDELRLPSALMTTGSRGLH
VVVPLNGRHGFDEVRHFARDVADTLAAGHPDRLTTAARKKDRDDRLYLDVQRNGYAQTAV
APFTVRARPGAPVAVPVAWDQLDEPGFGPRRWTVADAVDQARTNPWAGVMSRGRALGPAR
RRLDALRG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgcgcagacgcgcacggtacgggcgggccgccgtacggtcgaggtgcggcgg
cccggcaaggtcctcttcccggccggcgacggccacccggagtacaccaagggagacctc
gtcgactactaccggtccgtcgcgcccttcctgttgccccatgtgcgcggccggccgctg
atgctggagatgcacccggacggcgtcgacggccccgccttcatgcagaagaacaccccg
gacggctacccggactggatcacccgcgtcgaggtgcccaaggagggcggcaccgtccgc
cacaccgtctgcgacgactccgctaccctcgtccacctggccggccaggcctgtgtcacg
ctgcaccgctggctgtcgcgcggcgaccggccggaccaccccgaccggatggtcttcgac
ctcgacccctccggcgacgacttcgcacccgtgcgggagacggccgtgctgctcggtgaa
ctcctcgacgaactgcggctgccgtcggccctgatgaccaccggttcgcgcggactgcac
gtcgtggtgccgctgaacgggcggcacggcttcgacgaggtacggcacttcgcccgcgac
gtcgccgacacgctcgccgccggacaccccgaccggctcaccaccgccgcccgcaagaag
gaccgcgacgaccgcctctacctggacgtccagcgcaacggctacgcccagacggccgtc
gcccccttcaccgtccgcgcccgccccggcgcgcccgtcgccgtgcccgtcgcctgggac
cagctcgacgaacccggcttcgggccgcgccgctggaccgtcgccgacgccgtcgaccag
gcccgcaccaacccctgggcgggcgtgatgagccggggccgcgccctcgggccggcccgg
cgcaggctcgacgcgctgcgcggctga

DBGET integrated database retrieval system