KEGG   Streptomyces glaucescens: SGLAU_28040Help
Entry
SGLAU_28040       CDS       T03327                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
sgu  Streptomyces glaucescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIS01545
UniProt: A0A089XK21
LinkDB All DBs
Position
complement(6406903..6407955)
Genome map
AA seq 350 aa AA seqDB search
MPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDGAEVELGSRTGKPLTRYFPELVAAL
AERLPQRCVLDGEIVIAREGRLDFDALTERIHPADSRVRMLAERTPSSFVAFDLLALDAE
SLLDVPQVDRRALLVRALDAVAPPVHVAPATTDIEVARRWFEQYEGAGLDGVVAKPLNLR
YRPDERAMYKIKHERTADVVVAGYRLHKSGPVVGSLLLGLHDDRGVLQHVGVSAAFPMRQ
RAELVAELEPLRMTDVRGHPWAAWAEEAAHESARLPGAPSRWSSKKDLSWVPLRPERVAE
VAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEIFGER
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccccccgtgaagccgatgctcgccaagtccgtggcgaagatcccgccgggtatgcag
tacgaggcgaagtgggacgggttccgggcgatcgtgttccgggacggcgccgaggtggag
ctgggcagccgtaccggtaagccgctgaccaggtatttccccgagctggtggcggcgctc
gcggagcggctgccgcagcggtgcgtgctggacggggagatcgtgatcgcccgggagggg
cggctggacttcgacgcgctcacggagcggatccacccggcggactcccgggtgcggatg
ctggcggagcggacgccgtcctccttcgtcgccttcgacctgctggccctggatgccgag
tcgctgctggacgtgccgcaggtggaccggcgggcgctgctggtcagggcgctggacgcg
gtggctcccccggtgcacgtggcgccggcgacgacggacatcgaggtggcgcggcggtgg
ttcgagcagtacgagggcgcgggtctggacggggtggtcgccaagccgctgaacctgcgc
taccgcccggacgagcgcgccatgtacaagatcaagcacgagcggacggcggacgtcgtc
gtggcgggctaccgcctccacaagagcggcccggtggtcggctcgctgctgctcgggctg
cacgacgaccggggcgtcctccagcacgtgggcgtgtcggcggcgttcccgatgaggcag
cgggcggagctggtggcggagctggagccgctgcggatgacggacgtccgggggcatccg
tgggctgcctgggcggaggaggccgcgcacgagtcggcgcggctgcccggcgcgccgagc
cgctggtcgtccaagaaggacctgtcgtgggttccgctgcgacccgagcgggtcgcggag
gtggcgtacgaccacatggagaacggggccaggttccggcacacggcccggttccggcgc
tggcgccccgaccggacgccggagagctgcacctacgcccagctggaggaaccggtgcgg
tacgacctcgcggagattttcggcgagcggtga

DBGET integrated database retrieval system