KEGG   Streptomyces glaucescens: SGLAU_28150Help
Entry
SGLAU_28150       CDS       T03327                                 

Definition
(GenBank) fatty acid oxidative multifunctional enzyme
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00071  Fatty acid degradation
sgu00280  Valine, leucine and isoleucine degradation
sgu00281  Geraniol degradation
sgu00310  Lysine degradation
sgu00362  Benzoate degradation
sgu00380  Tryptophan metabolism
sgu00410  beta-Alanine metabolism
sgu00640  Propanoate metabolism
sgu00650  Butanoate metabolism
sgu00903  Limonene and pinene degradation
sgu00930  Caprolactam degradation
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
sgu01200  Carbon metabolism
sgu01212  Fatty acid metabolism
Module
sgu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGLAU_28150
   00650 Butanoate metabolism
    SGLAU_28150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGLAU_28150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGLAU_28150
   00310 Lysine degradation
    SGLAU_28150
   00380 Tryptophan metabolism
    SGLAU_28150
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGLAU_28150
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGLAU_28150
   00281 Geraniol degradation
    SGLAU_28150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGLAU_28150
   00930 Caprolactam degradation
    SGLAU_28150
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SGLAU_28150
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGLAU_28150
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SGLAU_28150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored PALP NAD_Gly3P_dh_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIS01567
UniProt: A0A089XI02
LinkDB All DBs
Position
6432981..6435182
Genome map
AA seq 733 aa AA seqDB search
MTESTTIRWEQDGTGVVTLVLDDPNQSANTMNQAFRDSLAAITDRLEAERDSIRGIIVTS
AKKTFFAGGDLRDLIRVTPETAQELFDGGMAIKRNLRRIETLGKPVVAAMNGAALGGGFE
LALACHHRIALDAPGSKIGCPEVTLGLLPGGGGVVRTVRLLGITDALLKVLLQGTQYSPR
RALENGLVHEVAETREDMLAKARAFIDAHPESQQPWDVPGYRIPGGTPAHPKFAANLPAF
PANLRKQTGGAPYPAPRNILAAAVEGSQVDFETAQVIEARYFVELAAGQISKNMIQAFFF
DLQAVNSGANRPKDIAPRQVRRVAVLGAGMMGAGIAYSCARAGIEVVLKDVSLEAALKGK
GHSEKLCAKAVSRGRTTQEKADALLARITPTADVQDLAGCDAVIEAVFEDTALKHKVFQE
IEQVVAPDALLCSNTSTLPITALAEGVQRQTDFIGLHFFSPVDKMPLVEIIKGERTGEEA
LARAFDLVRQINKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRAETKRAVEEAGGTWTPHPAEAVIDRMVDEFGRTGRSGGAGF
YDYDDSGRRAGLWPGLREHFTKPGHTIPFEDMQERMLFAEALDTVRLLEEGVLTSVADAN
IGSILGIGFPGWTGGVLQYINGYESRTGAGAGLPGFVARARELAERYGDRFTPPALLVEK
AEKGERFTDSDRA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcaccacgatccgctgggaacaggacggcaccggtgtcgtcaccctcgtc
ctcgacgacccgaaccagtccgcgaacaccatgaaccaggcgttccgggactccctcgcc
gcgatcaccgaccgcctggaggccgagcgggactccatccgcggcatcatcgtgacctcc
gccaagaagaccttcttcgcgggcggcgacctgcgcgacctcatccgggtcaccccggag
acggcccaggagctgttcgacggcggcatggccatcaagcggaacctgcgccgcatcgag
accctcggcaaacccgtcgtcgcggcgatgaacggcgcggccctcggcggcggcttcgag
ctggccctcgcctgccaccaccgcatcgccctggacgcgcccggctccaagatcggctgc
cccgaggtcaccctcggtctgctccccggcggcggcggtgtcgtgcgcacggtccggctg
ctcggcatcaccgacgcgctgctgaaggtgctgctccagggcacccagtacagcccgcgg
cgcgccctggagaacggcctggtgcacgaggtggccgagacgcgggaggacatgctcgcc
aaggcccgcgccttcatcgacgcccaccccgagtcgcagcagccctgggacgtgccgggc
taccgcattcccggcggcacccccgcgcacccgaagttcgcggccaacctgcccgccttc
cccgccaacctgcgcaagcagaccggcggcgcgccctacccggccccgcgcaacatcctc
gcggcggccgtcgagggctcccaggtcgacttcgagaccgcccaggtcatcgaggcccgc
tacttcgtggaactggcggccgggcagatctcgaagaacatgatccaggcgttcttcttc
gacctccaggctgtcaactccggtgccaaccggccgaaggacatcgccccgcgccaggtc
cgccgggtcgccgtgctcggcgccggaatgatgggcgcgggcatcgcctactcctgcgcc
cgcgcgggcatcgaggtcgtcctgaaggacgtctccctggaagcggccctcaagggcaag
ggccactccgagaagctgtgcgccaaggcagtctcccggggccgtaccacgcaggagaag
gccgacgcgctgctcgcccgcatcacgcccaccgccgacgtccaggacctggccggctgc
gacgccgtcatcgaggccgtcttcgaggacaccgccctcaagcacaaggtgttccaggag
atcgagcaggtcgtcgcgccggacgcgctgctgtgctcgaacacctccaccctgccgatc
accgcgctcgccgagggtgtgcagcgccagaccgacttcatcgggctgcacttcttctcc
ccggtcgacaagatgccgctcgtcgagatcatcaagggcgagcgcaccggcgaggaggcg
ctggcccgcgccttcgacctggtccggcagatcaacaagacgccgatcgtcgtcaacgac
tcgcgcggcttcttcacctcccgcgtgatcggccacttcatcaacgagggcgtggccatg
gtcggcgagggcatcgaacccgcgtcggtggagcaggcggcggcccaggcgggctacccg
gccaaggtgctgtcgctgatggacgagctgacgctgaccctgccgcgcaagatccgcgcg
gagacgaagcgggccgtcgaggaggccggcggcacctggaccccgcacccggcggaggcc
gtcatcgaccgcatggtcgacgagttcggccgcaccggccgcagcggcggcgccggcttc
tacgactacgacgacagcggcaggcgcgccgggctgtggccgggcctgcgcgagcacttc
acgaagccgggccacaccatccccttcgaggacatgcaggaacgcatgctcttcgccgag
gcactggacacggtgcggctgctggaggaaggcgtcctgacgtccgtcgccgacgccaac
atcggctccatcctcggcatcggcttcccgggctggaccggcggcgtgctccagtacatc
aacggctacgagagccgcacgggggcgggtgccggtctgcccggcttcgtggcccgcgcg
cgtgagctggccgagcgctacggcgaccggttcacgcccccggcgctgctggtggagaag
gcggagaagggggagcggttcaccgactcagaccgggcgtga

DBGET integrated database retrieval system