KEGG   Streptomyces glaucescens: SGLAU_28745Help
Entry
SGLAU_28745       CDS       T03327                                 

Definition
(GenBank) putative Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00020  Citrate cycle (TCA cycle)
sgu00480  Glutathione metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
sgu01200  Carbon metabolism
sgu01210  2-Oxocarboxylic acid metabolism
sgu01230  Biosynthesis of amino acids
Module
sgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGLAU_28745
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SGLAU_28745
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SGLAU_28745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AIS01683
UniProt: A0A089XCG3
LinkDB All DBs
Position
complement(6564674..6566893)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVKAYASQAGVAVETRDISLAGRIIAVFPEYLTEDQ
RIPDALAELGELAKTPEANIIKLPNISASIPQLKAAVAELQAQGYALPDYPDDPKTDEER
EIKARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTGESKTNVATMGEND
FRSTEKSVVIAEDGALRIELVAEDGTTTVLRDSVPVLAGEVVDASVMRVAHLREFLASQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFERYGETLAAAGLSPNDGLGGI
FKGLESLPEGAEIKASFDAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTIAVIPDSSYAGVYQAVIEDCKANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPAAGTVRLVDRSGDVLIEQPVSQGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDETRAHDANLIAKVEQYLPEHDTEGLDIRILSPVEATNLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYAAFTGNNRAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELARQTDDAELAKAFAPLAETLAANEQKIVEELNAVQGKPADIGGYYQPDPAK
AAEIMRPSATWNEVLASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtcaaggcgtacgcctcgcaggcgggtgtcgccgtggagacgcgg
gacatctcgctggccgggcgcatcatcgcggtgttcccggagtacctcaccgaggaccag
cgcatcccggacgcgctggccgagctgggcgagctggcgaagacgcccgaggccaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggccgccgtcgccgagctg
caggcccagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgg
gagatcaaggcccgctacgacaaggtcaagggctccgccgtgaacccggtcctgcgcgag
ggcaactccgaccgccgcgccccggcctccgtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggaccggcgagtccaagacgaacgtggccaccatgggcgagaacgac
ttccgctccaccgagaagtcggtcgtcatcgccgaggacggcgcgctgcggatcgagctg
gtcgccgaggacggcaccaccaccgtgctgcgcgactccgtaccggtcctcgccggtgag
gtcgtcgacgcctccgtgatgcgggtcgcccacctgcgcgagttcctggcctcccaggtc
gcccgcgccaaggccgagggcgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtccgcgccttcttcccgaagaccttcgag
cgctacggcgagaccctggccgccgccggcctctccccgaacgacggcctcggcggcatc
ttcaagggcttggagtcgctgcccgagggcgccgagatcaaggcctccttcgacgccgaa
ctggccgagggcccggccctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtcccgtcggacgtcatcgtcgacgcctccatgccggcgatgatccgcacctccggccac
atgtggggcccggacggccaggaggccgacaccatcgcggtcatcccggactcctcctac
gcgggcgtctaccaggccgtcatcgaggactgcaaggccaacggcgcctacgacccgtcc
accatgggctcggtgccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgagatcccggccgccggcaccgtccgcctggtcgaccggtccggc
gacgtcctcatcgagcagccggtctcccagggcgacatcttccgcgcctgccagaccaag
gacgcgccgatcagggactgggtgaagctcgccgtcacccgcgcccgcgccaccggcgac
ccggcggtgttctggctggacgagacccgcgcgcacgacgccaacctgatcgccaaggtc
gagcagtacctgccggagcacgacaccgagggcctggacatccgcatcctgtccccggtc
gaggccaccaacctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtcctgcgcgactacctgaccgacctcttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagacgggcgcc
ggcggctccgcgccgaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
tcgctcggcgagttcttcgccctggtgccgtccctggagcagtacgccgcgttcaccggc
aacaaccgcgccaaggtgctcgccgacaccctcgaccgggccacggcgaccttcctcaac
gaggacaagtccccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcccggcagaccgacgacgcggagctggcgaag
gccttcgccccgctcgccgagacgctcgcggcgaacgagcagaagatcgtcgaggagctg
aacgccgtccagggcaagccggccgacatcggcggctactaccagcccgacccggccaag
gccgccgagatcatgcgcccctcggccacctggaacgaggtcctggcgtccctgagctga

DBGET integrated database retrieval system