KEGG   Streptomyces glaucescens: SGLAU_29310Help
Entry
SGLAU_29310       CDS       T03327                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00020  Citrate cycle (TCA cycle)
sgu00190  Oxidative phosphorylation
sgu00650  Butanoate metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01130  Biosynthesis of antibiotics
sgu01200  Carbon metabolism
Module
sgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sgu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGLAU_29310
   00650 Butanoate metabolism
    SGLAU_29310
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SGLAU_29310
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SGLAU_29310
    1.3.5.4  fumarate reductase (quinol)
     SGLAU_29310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIS01796
UniProt: A0A089Z7P2
LinkDB All DBs
Position
6690563..6692512
Genome map
AA seq 649 aa AA seqDB search
MTTYADYSTGEPVADTKAPSGPVHERWDKRRFEARLVNPANRRKHTLIVVGTGLAGGSAG
ATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSVHRLFYDTVKGGDFRAR
ESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLG
AYQALSRQIAAGNVELHPRTEMLDLIVVDGRARGIVARDLITGKIETYVADAVVLASGGY
GNVFYLSTNAMNSNATAIWRAHRRGAYFANPCFTQIHPTCIPRTGDHQSKLTLMSESLRN
DGRIWVPKAKGDTRPPHRIPEDERDYYLERIYPSFGNLVPRDIASRAAKNVCDEGRGVGP
GGQGVYLDFADAIRRMGREAVEARYGNLFEMYQRITDEDPYQVPMRIYPAVHYTMGGLWV
DYDLQTTVPGLFAIGEANFSDHGANRLGASALMQGLADGYFVLPATINDYLARHPHQAEV
TGEHPVVQEVLAETEDRVNLLLAVDGDRTPDSFHREVGELMWEYCGMARTDAGLRKALER
IPQIREEFWRRIKVPGTGREFNQSLEKANRVVDYLELAELMCLDALHRTESCGGHFREES
QTPEGEAARKDEEFSYAAAWEFTGTGEAPVLHKEDLVFEYVHPTQRSYA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctacgccgactactcgaccggcgagccggtcgccgacaccaaggccccgtcc
ggccccgtccacgagcgctgggacaagcgccgcttcgaggcccggctggtcaaccccgcc
aaccggcgcaagcacacgctgatcgtcgtgggcaccggactcgcgggcggctcggccggc
gccaccctcgccgaacagggctaccacgtcgtccagttctgctaccaggactccccgcgc
cgcgcccactcgatcgccgcgcaaggcggcatcaacgcggcgaagaactaccgcaacgac
ggcgactccgtccaccgcctcttctacgacaccgtcaagggcggcgacttccgcgcccgc
gagtccaacgtgcaccggctcgcgcagatctccgtcgagatcatcgaccagtgcgtggcg
cagggcgtgccgttcgcccgcgagtacggcggcctgctcgacacccgttccttcggcggc
gtccaggtctcgcggaccttctacgcccgcggccagacgggccagcagctcctcctcggc
gcctaccaggcgctgagccggcagatcgccgcgggcaacgtcgagctgcacccgcgcacc
gagatgctggacctgatcgtcgtggacgggcgggcgcgcggcatcgtcgcccgcgacctg
atcaccgggaagatcgagacgtacgtcgcggacgccgtcgtcctcgcctccggcggctac
ggcaacgtgttctacctgtcgacgaacgccatgaactccaacgcgacggcgatctggcgg
gcgcaccggcggggcgcctacttcgccaacccctgcttcacccagatccaccccacctgc
atcccccgcaccggcgaccaccagtccaagctgaccctgatgagcgagtcgctgcgcaac
gacggccggatctgggtgcccaaggccaagggggacacccggccgccgcaccggatcccc
gaggacgagcgcgactactacctggagcgcatctacccgtccttcggcaacctggtcccg
cgtgacatcgcctcccgcgccgcgaagaacgtctgcgacgaggggcgcggcgtcggcccc
ggcgggcagggcgtctacctggacttcgccgacgccatccggcggatgggccgcgaggcc
gtggaggccaggtacggcaacctcttcgagatgtaccagcggatcaccgacgaggacccg
taccaggtgccgatgcggatctaccccgccgtgcactacacgatgggcggcctgtgggtc
gactacgacctccagaccaccgtccccggactgttcgcgatcggggaggccaacttctcc
gaccacggcgccaaccggctcggcgcctccgccctgatgcagggcctggccgacggttac
ttcgtgctcccggccaccatcaacgactacctcgcccgccatccgcaccaggccgaggtg
accggcgaacaccccgtcgtgcaggaggtgctggccgagaccgaggaccgcgtgaacctg
ctgctggccgtcgacggcgaccgcactcccgactccttccaccgcgaggtcggcgaactc
atgtgggagtactgcggcatggcccgcaccgacgccgggctgcgcaaggcgctggagcgg
atcccgcagatccgcgaggagttctggcggcggatcaaggtgcccggcaccggccgggag
ttcaaccagtcgctggagaaggccaaccgcgtcgtcgactacctggagctcgccgagctg
atgtgcctcgacgcgctgcaccgcaccgagtcctgcggaggccacttccgcgaggagtca
cagacccccgagggggaggccgcccgcaaggacgaggagttctcctacgccgccgcctgg
gagttcaccggtaccggcgaggcgcccgtcctgcacaaggaagacctggtcttcgagtac
gtccaccccacccagcggagctacgcatga

DBGET integrated database retrieval system