KEGG   Streptomyces glaucescens: SGLAU_33055Help
Entry
SGLAU_33055       CDS       T03327                                 

Definition
(GenBank) ATP-dependent polynucleotide modifying protein
Organism
sgu  Streptomyces glaucescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIS02539
UniProt: A0A089XGX3
LinkDB All DBs
Position
pSglau1:116531..117520
Genome map
AA seq 329 aa AA seqDB search
MLAQSRDTVPAPGALPGELRFQPKFDGYRAIVFTAWPAPGPLLVQSRRGSLLQSRFPDLV
DAAADLPDGLVLDGELVVWVEGQMSFEALQRRAVSGGRTAARLAQEMPAHFIAFDLLQLD
GQELLHVPYGERRARLEELFADRGLSAPWTLCPETTDPATAGEWLTSWTQVPGVEGLVIR
GSGQRYLPGARALYKVRRRDTTEAVVGAFTGTVRRPQTLVLGRLDAEGVLRPVARSTPLR
PDALRDLAGRLTLAGPGHPWESVRFMTSWGSRTPLDVVLVEPEMVAEIMVDTAQERGSWR
HPVRFARLRLDVAVTDVPPFGAGAEPASG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgcagtcccgtgacacggtgcccgcgccgggcgcgctgcccggtgagctgcgg
ttccagcccaaattcgacggctaccgggcgatcgtcttcaccgcgtggccggcgcccggc
ccgctgctcgtgcagtcccgccgcggcagcctcctgcagagccgcttcccggatctcgtg
gacgcggccgcggacctgccggacggcctggtcctggatggcgagctggtcgtgtgggtg
gaagggcagatgtcgttcgaggcgctccagcggcgagcggtctccggcggccggaccgct
gcccggcttgcgcaggagatgccggcgcacttcatcgccttcgacctcctccagctcgac
ggccaggagctattgcacgtcccgtacggcgagcggcgcgcgcggctggaggagctgttc
gccgaccgcgggctgagtgccccctggacgctgtgcccggagacgaccgacccggcgaca
gccggggagtggctgacgtcctggacgcaggtcccgggcgtcgaagggctggtgatccgg
gggagtggccagcggtatctgccgggagcccgcgcgctgtacaaggtgcgccgccgcgat
accaccgaagccgtggtgggcgcgttcacgggcaccgtgcggcggccgcagacgctcgtg
ctaggccgcctcgatgcagagggtgtgctccggccggtcgcccgcagtacgccgctgagg
ccggacgcgttgcgcgacttggccgggcggctgacgctcgccggacccggtcacccgtgg
gagagcgtccggttcatgacctcctgggggtcgcgcacgccgctcgatgtcgtgctggtg
gagccggagatggtcgccgagatcatggtggacacggcgcaggagcgcggatcgtggcgg
cacccggtgcgcttcgcccggctccggctagacgtcgcggtcacggacgtcccgcccttc
ggtgccggtgccgagcccgccagcggctga

DBGET integrated database retrieval system