KEGG   Streptomyces gilvosporeus: B1H19_03865Help
Entry
B1H19_03865       CDS       T05165                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00500  Starch and sucrose metabolism
sgv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B1H19_03865
Enzymes [BR:sgv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B1H19_03865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ARF59223
UniProt: A0A1V0U213
LinkDB All DBs
Position
823870..825156
Genome map
AA seq 428 aa AA seqDB search
MFRNIASDGFVFSDPQSPGDISRNSKPGCIIAAPSFPADTPGIDEDYVFNWVRDGAITAM
EVAKADMPTRPGGTVQTLNDYVQFADLCHSNAQPPLTKGHACFNIAGDARPWTEQNDGPA
LQTITILAAYDQLDVGTQKRAVDLVNSNVAYLLGVYQGPTTNLWEEHSGYSFFARAAQLR
CFEEIQGSTIVGIDKPTGLRPAIKWLRQALAGHWDGNTYISMLADPGDGSQPSPQNPVVS
GYDPNIDIVQSAVYGAVPVTDTKLLATAAQLRSQWEEGGIAFYPINKADKEGFGIGPLFG
RYPGDVYNGDTAHPQLGGHPWALSTFNVAELHYKLAGAIKASGKVPMDDLSAPFFAQSGI
DASTAPAAAAAALTATGDAMMQAVIYHSDNLELSEQFDGTTGFERSVHNLTWSYAAYLSA
MRARAEAV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttccggaacatcgccagtgacggattcgtcttcagcgatccgcagtcgccgggcgac
atttcccggaactcgaagccgggttgcatcatcgccgccccgtccttcccggccgacacc
cccggcatcgacgaggactacgtcttcaactgggtgcgcgacggcgccatcacggccatg
gaggtggccaaggccgacatgcccacccgcccgggcgggacggtgcagacgctcaacgac
tacgtgcagttcgccgacctctgccactccaacgcccagccgccgttgaccaaggggcac
gcctgcttcaacatcgccggtgacgcccgcccgtggaccgagcagaacgatggtccggcc
ctgcagacgatcaccatcctggccgcctacgaccagctcgatgtcggcacccagaagcgg
gcggtcgacctggtgaactcgaacgtggcctacctcctcggcgtctaccagggccccacc
acgaacctgtgggaggagcacagcgggtacagcttcttcgcccgcgccgcccagctgcgc
tgcttcgaggagatccagggctcgaccatcgtcggcatcgacaagccgaccggactgcgg
cccgccatcaagtggctgcgccaggcccttgccggccactgggacgggaacacgtacata
agcatgctggccgaccccggtgacgggtcccagccgtcgccccagaatccggtcgtcagc
ggttacgacccgaacatcgacatcgtccagtcggccgtctacggcgccgttcccgtcacc
gacaccaagctgctggcgacagcggcccaactgcgctcgcagtgggaggagggcggcatc
gccttctacccgatcaacaaggccgacaaggaaggcttcggtatcggcccgctgttcggc
cgctacccgggcgacgtctacaacggtgacaccgcgcacccgcagctcggcggccacccc
tgggccctctccacgttcaacgtcgccgagctgcactacaagctggccggcgcgatcaag
gcgagcggcaaggtgcccatggacgacctctccgcacccttcttcgcccagtccggcatc
gacgcgtcgacggccccggcggcagccgccgccgccttgacggcgaccggtgacgccatg
atgcaggccgtcatctaccacagcgacaacctggagctctccgagcagttcgacggcacc
accggcttcgagcgcagtgtgcacaacctgacgtggagctatgccgcctacctgtccgcc
atgcgggcccgggccgaggccgtgtga

DBGET integrated database retrieval system