KEGG   Streptomyces gilvosporeus: B1H19_08245Help
Entry
B1H19_08245       CDS       T05165                                 

Definition
(GenBank) neuramidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00511  Other glycan degradation
sgv00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sgv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B1H19_08245
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B1H19_08245
Enzymes [BR:sgv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     B1H19_08245
Bacterial toxins [BR:sgv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   B1H19_08245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3
Motif
Other DBs
NCBI-ProteinID: ARF59300
UniProt: A0A1V0U2N8
LinkDB All DBs
Position
1886613..1887764
Genome map
AA seq 383 aa AA seqDB search
MSLAVFLATGTGLVSATPAAATPAPDPTTPLYESTDLAVSGQGAHTYRIPALETLPDGTL
VAAYDRRNDSASDLPGNVDVMVRRSTDDGRTWSPPEAVADYDGGAGAGDPSLIVDRWTGR
LFLFHMYGPRGIGFGNAGMGNDHRSTSILHTDYHYSDDGGRSWRARRLTRDLKDPKWLGI
FASSGTGIQLSSGRLLQQYVLRKADASMWAASAYSDDHGKTWRLGTPVGPQMDENKTVEL
ADGRIMLNSRTGSTTRRLVAYSRDGGLTYSTPVPDDELVDPVNNASILRYDPDAPPGLPR
AHWLLFSNTASTSARRNLTVRLSCDDGRSWPVSRVVTPGPAAYSTLTRLKDGTFGLLYES
GPYRKITFARFNDAWLGAPCPAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ctgtcgctggccgtcttcctcgccaccggcaccggtctggtgtcggccacccccgcggcc
gccacccctgcccccgatcccaccactcctctctacgagtccaccgacctggcggtctcg
ggccaaggggcgcacacctaccgcatccccgcgctggagacgctccccgacggcaccctc
gtcgccgcctacgaccggcgtaacgacagcgcctccgacctgcccggcaatgtcgatgtg
atggtgcggcgcagcaccgacgacgggcggacctggagccccccggaggcggtcgccgac
tacgacggcggggccggcgccggcgaccccagcctgatcgtcgaccgctggaccggccgc
ctcttcctcttccacatgtacggccccaggggcatcggcttcggcaacgcgggcatgggc
aacgaccaccgcagcaccagcatcctgcacaccgactaccactactccgacgacggcggc
cgcagctggcgcgcccgccggctgacccgcgacctcaaggacccgaagtggctgggcatc
ttcgcctcgtccggcaccggcatccagctctcctccgggcggctgctccagcagtacgtg
ctccgcaaggccgacgccagcatgtgggcggccagtgcctacagcgacgaccacgggaag
acctggcggctggggacgccggtcgggccgcagatggatgagaacaagaccgtcgaactg
gccgatggccgcatcatgctcaacagccgtaccggcagcaccacacggcggctggtcgcc
tactcccgggacggcgggctgacctacagcacgccggtcccggacgacgagctggtcgac
ccggtcaacaatgcgtcgattctgcgctacgacccggacgcgccgccgggccttcctcgg
gcgcactggctgctgttcagcaatacggcgagcaccagcgcgcgccggaacctcaccgtc
cggctgtcctgcgacgacggccgcagctggccggtctcacgggtcgtcacgcccggcccg
gcggcgtactccaccctgacccggctcaaggacggcacgttcgggctgctctacgagtcg
ggcccgtaccggaaaatcaccttcgcacggttcaacgacgcctggctgggcgcaccctgt
ccggccggatga

DBGET integrated database retrieval system