KEGG   Streptomyces gilvosporeus: B1H19_08405
Entry
B1H19_08405       CDS       T05165                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00997  Biosynthesis of various secondary metabolites - part 3
sgv01100  Metabolic pathways
sgv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    B1H19_08405
Enzymes [BR:sgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     B1H19_08405
SSDB
Motif
Pfam: DeoC ThiG OMPdecase
Other DBs
NCBI-ProteinID: ARF54214
UniProt: A0A1V0TMQ1
LinkDB
Position
1920600..1921421
AA seq 273 aa
MPLLPLSGKSLRLTRLSRPGDGKFLIVPMDHSVADGPIADATGFSRLIGDVVAAGADAVV
VHKGRARTIEPGLLNGAALIVHLSASTPHAPDGDAKVLVGSVEEAVRAGADAVSVHINIG
SDTEKRQLADLGTIAAGCERWGMPLLAMMYARGPRIQDPRDPALLAHVVSIAVDLGADLV
KTVAAGSAEDMAGIVAKTPVPVVVAGGAGDGRSLTDFAHFAMDAGCRGLAVGRRVFHSPD
PGAAVRALSAAVHAPRPQTAPNSTSLPELAGAM
NT seq 822 nt   +upstreamnt  +downstreamnt
gtgcccctactacctctgagcggaaaatcgctgcgcctcacccggctttccaggcccggc
gacggaaaatttctcatcgtgcccatggatcattccgtggccgacggaccgatagccgac
gccaccggattcagccgcctcatcggcgatgtggtggccgccggcgccgacgccgtcgtc
gtccacaaggggcgcgcccgcaccatcgagccgggcctgctcaacggcgccgccctgata
gtccacctcagcgccagcactccgcacgcccccgacggcgacgccaaggtcctggtcggc
agcgtggaggaggcggtgcgcgccggggctgacgccgtcagcgtgcacatcaacatcggc
tcggacaccgagaaacgccagctcgccgatctcggcacgatcgcggcgggctgcgagcga
tggggtatgccgctgctggcgatgatgtacgcacgggggccgcgcatccaggacccccgc
gaccccgcgctccttgcccatgtggtgagcatcgccgtcgacctcggcgcggacctcgtc
aagaccgtcgcggcgggctccgcggaggacatggcgggcatcgtcgccaagaccccggtc
ccggtcgtcgtggccggcggcgcgggcgacggccgcagcctcaccgatttcgcgcatttc
gcgatggacgccggctgccgcggactcgccgtcggccgccgggtcttccacagccccgac
ccgggggcggcggtccgcgccctgtccgccgccgtccatgcaccacgaccgcaaaccgcc
ccgaattcaacctccctacccgaactggcaggtgcgatgtga

DBGET integrated database retrieval system