KEGG   Streptomyces gilvosporeus: B1H19_17265Help
Entry
B1H19_17265       CDS       T05165                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00620  Pyruvate metabolism
sgv00680  Methane metabolism
sgv01100  Metabolic pathways
sgv01120  Microbial metabolism in diverse environments
sgv01200  Carbon metabolism
Module
sgv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sgv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1H19_17265
  Energy metabolism
   00680 Methane metabolism
    B1H19_17265
Enzymes [BR:sgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B1H19_17265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ARF55694
UniProt: A0A1V0TRV2
LinkDB All DBs
Position
complement(3941642..3944401)
Genome map
AA seq 919 aa AA seqDB search
MSSADNAAPSVTTPTDDAASDHTALRADIRRLGDLLGETLVRQEGHELLDLVERVRALTR
SDGEAAARLLGETDLATATKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGILARTAD
MLKDADPEHLRQTAANLGVRPVFTAHPTEAARRSVLTKLRKVAELLDHPDATDIRRTDLR
LAENIDLIWQTDELRVARPEPTDEARNAIYYLDELGRGAVGDVLEDLAAELERAGTELPA
GTRPLTFGTWIGGDRDGNPNVTPQVTWDVLILQHEHGITDALEHIDELRGALSNSIRNCG
ATQELLDSLKRDLDLLPEFSPRYKRLNAEEPYRLKATCIRQKLLNTRERLAGDTPHVPGR
DYLGTAELLDDLALIQTSLRAHRGGLVADGRLERTLRTIAAFGLQLATMDVREHADAHHQ
ALGQLFDRLGEESWRYVDMPRDYRRKLLAKELRSRRPLAPTPAPLDEAGAKTLGVFRTIL
KAKKTFGPEVIESYIISMCQGSDDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELK
IADQLLDEMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRLLRDVAH
RHGVRLRLFHGRGGTVGRGGGPSHDAILAQPYGTLEGEIKVTEQGEVISDKYLVPSLARE
NLELTVAATLQASALHTAPRQSDEALARWDAAMETVSEAAHGSYRRLVEDPDLPAYFFAS
TPVDQLAELHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGTGLKAAREA
GLDSVLDEMHAHWHFFRNFLSNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDLIKAEHEL
TVQEVLRITGEKELLDSNPVLKQTFHIRDAYLDPISYLQVSLLHRQREAAARGEEADPVL
SRALLLTVNGVAAGLRNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacaacgccgccccgtccgtaaccacccccacggacgacgcggccagc
gaccacaccgccctgcgcgccgatatccgccgcctcggcgacctcctcggcgagaccctc
gtccgccaggaaggccacgagctgctggacctggtcgagcgcgtacgggccctgacccgg
tccgacggcgaggccgccgcccggctcctgggcgagaccgacctggccaccgccaccaag
ctggtgcgggccttctccacctacttccacctcgccaatgtcaccgagcaggtccaccgc
ggccgcgagctgcgcgcccggcgcgccgccgagggcggcatcctggcccgcaccgccgac
atgctcaaggacgccgatcccgagcacctgcgccagaccgccgccaacctcggcgtacga
cccgtcttcaccgcccaccccaccgaggccgcccgccgctccgtgctgaccaagctgcgc
aaggtcgccgagctgctggaccaccccgacgccaccgacatccgccgcaccgacctgcgc
ctcgcggagaacatcgacctcatctggcagaccgacgagctgcgcgtggcccgcccggag
cccaccgacgaggcccgcaacgccatctactacctcgacgagctcggccgcggcgccgtc
ggcgacgtcctcgaagacctcgccgccgaactggagcgcgccggcaccgagctgcccgcc
ggcacccgcccactgacgttcggcacctggatcggcggcgaccgcgacggcaaccccaac
gtcaccccgcaggtcacctgggacgtcctgatcctccagcacgagcacggcatcaccgac
gccttggagcacatcgacgagctgcgcggcgccctgtcgaactccatccgcaactgcgga
gccacccaggagctgctcgactccctcaagcgggacctggacctgctgcccgagttcagc
ccccgctacaagcgcctcaacgccgaggagccgtaccgcctcaaggccacctgcatccgg
caaaagctcctcaacacccgcgaacgcctcgccggcgacaccccccacgtacccggccgc
gactacctgggcaccgccgaactcctcgacgacctggccctcatccagacctcgctgcgc
gcacaccgcggcggcctggtcgccgacggccgcctggagcgcaccctgcgcaccatcgcc
gccttcggcctccagctcgccaccatggacgtccgcgagcacgccgacgcccaccaccag
gccctcggccagctcttcgaccgcctcggcgaagagtcctggcgctatgtcgacatgccg
cgcgactaccgccgcaagctcctcgccaaggaactgcgctcccgccgccccctggccccc
accccggcccccctcgacgaggccggcgccaagaccctcggcgtgttccgcaccatcctc
aaggccaagaagaccttcggccccgaggtcatcgagtcgtacatcatctccatgtgccag
ggctccgacgacgtcttcgccgccgccgtcctggcccgcgaggccgggctcatcgacctg
cacgccggctgggccaagatcggcatcgtcccgctgctggagaccacggacgagctgaag
atcgccgaccagctgctcgacgagatgctctccgacccgtcctaccgccgcctggtcgcc
ctgcgcggcgacgtccaggaggtcatgctcggctactccgactcctccaagttcggcggc
atcaccaccagccagtgggaaatccaccgcgcccagcgcctgctgcgcgacgtcgcccac
cggcacggcgtacggctgcgcctcttccacggccgcggcggcaccgtcggccgcggcggc
ggcccctcccacgacgccatcctcgcccagccctacggcaccctcgaaggcgagatcaag
gtgaccgaacagggcgaggtcatctccgacaagtacctggtgccctcgctggcccgcgaa
aacctggaactgaccgtcgcggccaccctccaggcatccgccctgcacaccgccccccgc
cagtccgacgaggccctcgcccgctgggacgccgccatggagaccgtctccgaggccgcc
cacggctcctaccgccgcctggtcgaagacccggacctgcccgcgtacttcttcgcctcc
acccccgtcgaccagctcgccgaactccacctcggctcgcgcccctcccgccgccccgac
tccggcgccggactcgacggactgcgcgccatcccctgggtcttcggctggacccagtcc
cgccagatcgtccccggctggtacggcgtcggcaccggcctcaaggccgcccgcgaagcc
ggactcgacagcgtcctggacgaaatgcacgcgcactggcacttcttccgcaacttcctg
tccaacgtcgagatgacgcttgccaagaccgatctgcgcatcgcccagcactacgtcgac
accctcgtccccgacgagctcaagcacgtcttcgacctcatcaaggccgagcacgagctg
accgtccaggaagtcctgcgcatcacgggcgagaaggaactgctcgactccaaccccgtc
ctcaagcagaccttccacatccgcgacgcctacctcgacccgatctcctacctccaggtc
tccctgctgcaccgccagcgcgaggccgccgcccgaggagaagaggccgacccggtgctc
tcgcgcgccctgctcctcaccgtcaacggcgtcgccgccggcctgcgcaacaccggctga

DBGET integrated database retrieval system