KEGG   Streptomyces gilvosporeus: B1H19_23330Help
Entry
B1H19_23330       CDS       T05165                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00250  Alanine, aspartate and glutamate metabolism
sgv00410  beta-Alanine metabolism
sgv00430  Taurine and hypotaurine metabolism
sgv00650  Butanoate metabolism
sgv01100  Metabolic pathways
sgv01110  Biosynthesis of secondary metabolites
sgv01120  Microbial metabolism in diverse environments
sgv02024  Quorum sensing
Module
sgv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B1H19_23330
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1H19_23330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1H19_23330
   00430 Taurine and hypotaurine metabolism
    B1H19_23330
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B1H19_23330
Enzymes [BR:sgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B1H19_23330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ARF56712
UniProt: A0A1V0TVI5
LinkDB All DBs
Position
complement(5229276..5230694)
Genome map
AA seq 472 aa AA seqDB search
MTLHKGASDRDRQRTVRHPVNPFYGEADPVAGLMASPPQHALPEGPLSPHTAYQFVHDEL
MLDGNARLNLATFVTTWMEPQAGILMGECRDKNMIDKDEYPRTAELEKRCVAMLADLWHA
PAPASAVGCSTTGSSEACMLAGMALKRRWMRRNDDRYPGNARPNLVMGANVQVCWEKFCT
FWEVEARQVPMEGDRFHLDAESAAGLCDENTIGVVAILGSTFDGSYEPVADICAALDEVQ
EKKGWDIPVHVDGASGAMIAPFLDPEVVWDFRLPRVASINTSGHKYGLVYPGVGWALWRN
EEALPEELVFRVNYLGGDMPTFALNFSRPGAQVAAQYYTFLRLGRTGFRAVQQATRDVAR
TMADRIDAFADFRLLTRGDDLPVFAFTTADEVKAFDVFDVSRRMKERGWLVPAYTFPPNR
EDLSVLRIVCRNGFSHDLAEMFLADLEQLLPELRDQTGPLQRPESMATAFHH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccacaaaggcgcatccgaccgggaccggcagcgcaccgtccgccacccggtc
aatcccttctacggcgaggccgaccccgtggcgggcctgatggcctcgccgccgcagcac
gccctgcccgagggcccgctctccccgcacaccgcctaccagttcgtccacgacgagctg
atgctggacggcaacgcccggctcaatctggccacgttcgtcaccacctggatggagccg
caggccggcatcctgatgggcgagtgccgggacaagaacatgatcgacaaggacgagtac
ccgcgcaccgccgagctggagaaacggtgcgtggcgatgctcgccgacctctggcacgcg
cccgccccggcgtccgccgtcggctgttccaccaccgggtcgagcgaggcgtgcatgctc
gccggaatggccctcaagcggcgctggatgcgccggaacgacgaccggtatccgggcaac
gcgcggcccaacctcgtcatgggcgccaacgtccaggtctgctgggagaagttctgcacc
ttctgggaggtcgaggcgcgccaggtcccgatggagggcgaccgcttccatctggacgcg
gagagcgccgccggcctctgcgacgagaacaccatcggggtcgtcgccatcctgggctcg
accttcgacggatcgtacgagccggtggccgacatctgcgccgccctggacgaggtccag
gagaagaagggctgggacatccccgtccatgtcgacggagcgtccggcgcgatgatcgcg
ccgttcctcgacccggaggtggtgtgggacttccggctgccgcgggtcgcctccatcaac
acctccgggcacaagtacggcctcgtctacccgggcgtgggctgggcgctgtggcgcaac
gaggaggcgctgcccgaggagctggtcttccgggtcaactacctgggcggcgacatgccg
accttcgccctcaacttctcccgccccggcgcccaggtcgccgcgcagtactacaccttc
ctgcggctgggcaggaccggcttccgcgccgtccagcaggcgacccgcgacgtggcccgc
accatggccgaccggatcgacgccttcgccgacttccgcctcctgacccgcggcgacgac
ctgcccgtcttcgccttcacgaccgccgacgaggtgaaggccttcgacgtcttcgacgtg
tcccggcggatgaaggaacgcggctggctggtgcccgcctacaccttccccccgaaccgc
gaggacctctccgtcctgcgcatcgtctgccgcaacggcttctcccacgatctcgccgag
atgttcctcgccgacctcgaacagctcctgcccgaactccgcgaccagacggggccgttg
cagcgtccggagagcatggccacggccttccaccactga

DBGET integrated database retrieval system