KEGG   Streptomyces gilvosporeus: B1H19_32215Help
Entry
B1H19_32215       CDS       T05165                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00250  Alanine, aspartate and glutamate metabolism
sgv00410  beta-Alanine metabolism
sgv00640  Propanoate metabolism
sgv00650  Butanoate metabolism
sgv01100  Metabolic pathways
sgv01120  Microbial metabolism in diverse environments
Module
sgv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B1H19_32215
   00650 Butanoate metabolism
    B1H19_32215
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1H19_32215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1H19_32215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgv01007]
    B1H19_32215
Enzymes [BR:sgv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B1H19_32215
Amino acid related enzymes [BR:sgv01007]
 Aminotransferase (transaminase)
  Class III
   B1H19_32215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ARF58232
UniProt: A0A1V0TZY0
LinkDB All DBs
Position
7275670..7276992
Genome map
AA seq 440 aa AA seqDB search
MTHVPHDAPGLHARHQAVLPSWLALYYDRPLEITHGEGRHVWDAEGNRYLDFFGGILTTM
TAHALPEVTKAVAEQAGRILHTSTLYLSRPMVELAERIATLSGIPDARVFFTTSGTEATD
TALLLATCYRRSNQILAMRNSYHGRSFSAVGVTGNHSWSPTSLSPLQTLYVHGGIRTRGP
YAHLNDRDYITACVADLEDVLDQTAGGVAALIAEPVQGVGGFTAPPDGLYAAFREVLARH
GILWISDEVQTGWGRTGDHFWGWQAHADNGPPDLLTFAKGIGNGMSLGGVVARAEVMNSL
PANSISTFGGSPITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRGVAAGLDVVREVRG
RGLMIGVELVRPGTGDRSPEAASLVLEAARERGLLVGKGGQGGATLRIAPPMTLTVAEAE
EGAELLAQALEEAQGRLVGS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacgtcccccatgatgcgccgggcctgcacgcccgccaccaggccgtcctgccc
tcctggctcgccctgtactacgaccgccccctcgaaatcacccacggcgagggccgccac
gtctgggacgccgagggcaaccgctacctcgacttcttcggcggcatcctcaccaccatg
acggcacacgccctgcccgaggtgaccaaggcggtcgccgagcaggccggccgcatcctg
cacacctccacgctctacctctcccgccccatggtcgagctggcggaacggatcgccacg
ctctccggaatccccgacgcccgggtcttcttcaccacctcgggtaccgaggccaccgac
acggccctcctgctggccacctgctaccgccgctccaaccagatcctggcgatgcgcaac
agctaccacggccggtccttctccgccgtcggcgtcaccggcaaccacagctggtcgccc
accagcctctcgcccctccagacgctctacgtccacggcggcatccgcacccggggcccc
tacgcccacctgaacgaccgcgactacatcacggcctgcgtcgccgacctggaggacgtg
ctcgaccagaccgcgggcggggtcgccgccctgatcgccgaaccggtccagggcgtcggc
ggcttcaccgcgccccccgacggcctctacgccgccttccgcgaggtcctcgcccgccac
ggcatcctctggatcagcgacgaggtgcagaccggctggggccgcaccggcgaccacttc
tggggctggcaggcacacgccgacaacggcccgccggacctgctgaccttcgccaagggc
atcggcaacggcatgtccctcggcggcgtcgtcgcccgcgccgaggtcatgaactccctg
cccgcgaactccatttccaccttcggcggcagccccatcaccatggccgcgggcctcgcc
aacctcacctacctcctcgaacacgacctccagggcaacgcccggcgcgtcggcggtctg
ctcatcgagcggctgcggggcgtcgcggccggactcgacgtcgtacgggaggtccgcggc
cgcggcctgatgatcggcgtcgaactggtccgccccggcaccggcgaccgctcgcccgag
gccgcctcgctggtcctggaggccgcccgcgaacgcggtctcctcgtcggcaaaggcggc
cagggcggcgccaccctgcggatcgcacccccgatgaccctgaccgtcgcggaggcggag
gagggcgcggaactcctcgcccaggcgctggaggaggcgcaggggaggctggtgggctcg
tag

DBGET integrated database retrieval system