KEGG   Streptomyces gilvosporeus: B1H19_36280Help
Entry
B1H19_36280       CDS       T05165                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sgv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    B1H19_36280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sgv03400]
    B1H19_36280
Enzymes [BR:sgv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B1H19_36280
DNA repair and recombination proteins [BR:sgv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     B1H19_36280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ARF58917
UniProt: A0A1V0U1A0
LinkDB All DBs
Position
8215723..8216622
Genome map
AA seq 299 aa AA seqDB search
MSPITIVEGRRLSLTNLHKVIYPQTGTTKGEVVHYCTVTADPLLAHLHDRPLSFLRYPDG
PDGQRFFTKNVPPGAPTWVQTCEVPHTSSGPTRQVLVQDLPSLVWAANLVVELHAPQWTS
GAPGRADRLVLDLDPGDPATIVECCTAAQWLHERLAADGLEAYAKTSGAKGLHLLVPIEP
TPSERATAYARGLAVEAAKALPDLVVHKMTRALRPGKVFIDFSQNAAAKTTAVAYTLRAR
ALPTVSTPVTWDEIAACTEPAQLAFRFEDIAPRLARHGDLHAPLLDPARARPLPGDGRR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgatcaccatcgtggaggggcggcgcctctcgctgaccaacctgcacaaggtc
atctatccgcagaccggcaccaccaagggcgaggtggtgcactactgcaccgtcaccgcc
gatccgctgctcgcgcacctccacgaccgtccgctgtcctttctgcgctatcccgacggg
cccgacggccagcgcttcttcaccaagaacgtgccgcccggcgcccccacctgggtgcag
acctgcgaggtgccgcacacgtcctccgggcccacccgccaggtgctggtgcaggacctc
ccctcgctggtgtgggccgcgaacctggtcgtcgagctgcacgcaccccaatggaccagc
ggggcgccggggcgcgccgaccgcctcgtcctcgatctcgaccccggcgacccggccacc
atcgtggaatgctgcaccgccgcgcagtggttgcacgagcggctggccgcggacggactg
gaggcgtacgccaagaccagcggcgccaagggcctgcatctcctcgtgcccatcgagccg
accccctcggagcgggccacggcctacgccaggggcctcgccgtcgaggcggccaaggcc
ctcccggacctcgtcgtgcacaagatgacgcgcgccctgcgccccggcaaggtcttcatc
gacttctcccagaacgccgccgccaagaccaccgccgtcgcctacaccctgcgcgcccgc
gcgctgcccaccgtctccacgccggtcacctgggacgagatcgccgcctgcaccgagccc
gcccaactcgccttccgcttcgaggacatcgcgccccgcctcgcccgccacggcgatctg
cacgccccgctcctcgaccccgcccgcgcccgcccgctgcccggcgacggccgccggtga

DBGET integrated database retrieval system