KEGG   Syntrophobotulus glycolicus: Sgly_0186Help
Entry
Sgly_0186         CDS       T01429                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer with Cache sensor
  KO
K03406  methyl-accepting chemotaxis protein
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy02020  Two-component system
sgy02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sgy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sgly_0186
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Sgly_0186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:sgy02035]
    Sgly_0186
Bacterial motility proteins [BR:sgy02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Sgly_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal sCache_2 dCache_2 HAMP DUF948 T7SS_ESX_EspC BLOC1_2 DUF1664 7TM_GPCR_Srv AI-2E_transport DUF1043
Motif
Other DBs
NCBI-ProteinID: ADY54557
UniProt: F0SW71
LinkDB All DBs
Position
194691..196460
Genome map
AA seq 589 aa AA seqDB search
MKSIKNRLIMNMVIVACITLLVLGSYTIYSLKSINDQDLENYKDTLYQSFDREIKLEVET
AVSLIDQVHKKQLNGELTEAQARAMAADLVRQLRFDENTSYFWIDTTAGVNVVLPGDQAE
GTNRLNAQDSNGVKYVEEFIKNSKLSGGGYTDYAFPHPGETVAVAKRGYTLLYQPYNWVI
GTGNYIDDIQEVVLVTEQKKRAEFYSHMLMSLLAVIVSLGVSVLLGVYFGRKIANPIVQI
TDSVKKVAEGDLRVEKIEIANQDELGQLAQGFNTMTENLRQLVKQITGSSSQLASASQQL
SAGAEQLAKAASSVAEVISEVSVGTEKQLEAVTEVSVVVEEMNTAFGNIITEVKTVTEVS
EQTTLTAEEESLEIDNTMTQMANIETSTNNAAQLVNHLGERSREIGQIVDTISGIAEQTN
LLALNAAIEAARAGDQGRGFAVVADEVRKLAEQSQDAAKQIADLIKQIQQDTDRAVSAMN
SGTEEVKTGTNSVNNAGKTFKQIATLISNVSERVNESAELLNQTAMNSEKIVGAVLEVDR
ISREIAAQTQSVNAAVEEQTASSEEIASSSNMLMKNAEEMQNILSRFHI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagcatcaagaacagactcattatgaatatggttattgttgcatgtataaccttg
ctggttttgggctcttatacaatttatagcctcaaatctatcaatgatcaggatctggag
aattataaggatacgttatatcagagttttgacagggaaatcaagctggaagttgaaact
gctgtaagtttaattgatcaggtacataagaaacaattaaatggagaattgactgaagcc
caggcgagggcaatggccgcggatttagtcaggcagctgcgttttgatgaaaataccagc
tatttctggattgatacaactgcaggtgttaatgttgtgcttcccggcgatcaggcggaa
ggcacaaaccgtctgaatgcccaggactccaacggtgtaaagtatgtggaggaatttatt
aaaaacagcaagctttcaggcggagggtatacggattatgcttttccccatccgggggaa
acagttgctgttgccaaaagaggctataccttgttatatcagccttataactgggttatt
ggcacaggtaattatatcgatgatattcaggaagttgttttagtaaccgaacaaaagaaa
agagcggaattttattcccacatgctgatgtcactgttggctgtaatcgtttcccttggt
gtatcggtacttttaggggtttattttggaagaaagatcgccaatccgattgtccaaatt
acagattcagtgaaaaaggttgctgaaggtgacctgcgcgtagagaaaattgagattgcc
aatcaggatgaactcggacagcttgctcaggggttcaatacaatgacagagaacttacga
cagctggttaaacaaattaccgggtcatcgagccagcttgcatcagcttcccagcagttg
tcggcaggtgcggaacagcttgcgaaagctgcctcttctgttgcggaggtaatttccgaa
gtttctgtcggaaccgagaaacagttggaagcggtcacagaggtttcggtagttgttgaa
gaaatgaatacggctttcggcaatattattactgaggtaaagacggtgacggaggtttct
gagcaaaccaccttgacagctgaggaggaaagcctggaaattgacaacacaatgacccaa
atggccaatattgaaacatcaacgaacaatgccgcccagcttgtcaatcatctgggagag
cgttccagagaaatcggacaaatcgtagacacgatttccggcatagcggagcaaacgaat
ctattggcgttaaatgcggccattgaagcggccagggccggtgaccaggggagaggattt
gctgttgttgcagatgaagtgcgtaaactggcagaacagtctcaagatgctgccaagcag
attgcggacctgatcaaacagattcaacaggatacggaccgggctgtcagtgccatgaat
tcaggcacggaagaggttaaaacgggaaccaattccgtcaataatgcgggcaaaaccttt
aaacagattgccaccctgatcagcaacgtttccgaaagagtcaatgaatccgctgaactg
ctcaaccaaacggcaatgaacagtgaaaagattgttggagcagtgcttgaggtggataga
ataagcagggaaatcgctgctcagactcagtctgtaaatgccgcggttgaggaacagacc
gcctcatccgaagagattgcatcttcgagcaatatgctgatgaagaatgccgaagaaatg
caaaatattctttccaggttccatatctga

DBGET integrated database retrieval system