KEGG   Syntrophobotulus glycolicus: Sgly_0962Help
Entry
Sgly_0962         CDS       T01429                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD polymerase module;ATP-dependent DNA ligase LigD phosphoesterase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sgy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Sgly_0962
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sgy03400]
    Sgly_0962
Enzymes [BR:sgy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Sgly_0962
DNA repair and recombination proteins [BR:sgy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Sgly_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADY55303
UniProt: F0T2I5
LinkDB All DBs
Position
948890..951331
Genome map
AA seq 813 aa AA seqDB search
MDRKLNDYNEKRNFARTTEPEGAREMAREGLRFVVQHHLARRDHYDFRLEWDGALLSWAV
PKGPSYNTRDKRLAVQVEDHPLEYRNFEGTIPKGEYGGGVVMLWDEGYWEPDGNVDDGLR
AGMLKFVLKGRRLKGKWALVRLKKKAGETKDNWLLLKEKDQYAKTGDEVSQFATSIRTGR
TMKEIEEGEDEKITPNPFGSTGVQLAKLVRMVPEGEDWLYELKYDGYRIVAYMEGGSARL
LTRNGRDYTARFPDVASSLSDWAGGRAMILDGEMAVTDAAGRTDFQALQNYLNNAQAQSL
TYIIFDLLALDGADLRGHRLLDRKGTLEALLKDAPENLYYSRHVSGNGRESFAAACAAGL
EGIIGKKADSLYSGTRNGDWIKLKCEQRQEFVIGGYTLSAKKTSGVSSLLLGVYEGQGLV
YAGRAGTGLSEAGRRELAEKFAGRERTEPPFRLPPKARANEKITWLEPELVAEIKFAEWT
KDDLLRQASFKGLRTDKKPEEIKREKTDGERQPPPSAKETERAMEANTNSIMIEGIKITN
PDKVIFTDPETTKGDVVRYYAQVAERMLPYVSRRVLSIVRCPKGIAQTCFYKKHPGPGSK
GIVTIPVTNSDGETEEYFYIENTSGLIAEAQMGTLEFHTWGSRADELEKPDLMVFDLDPD
EGMDLSRVRQGVRDMKDLLTELSLRAYLKTSGGKGYHVVVPLKPSVSWDRFYDFARRVAE
VMEQKWPDRYTSNVRKAKRAGKIFIDWMRNGRGATSIAPYSLRAREGTRVSMPIAWEELD
TVAPDSVNMAEALRRIGGNDPWQGFFRNGQQLK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaagctgaacgactacaacgaaaaaaggaattttgccaggaccacggaaccg
gaaggggcaagagaaatggcccgggaaggcttaaggtttgtcgtccagcaccatctggcc
cgcagggatcactatgatttccgcctggaatgggacggagctctcttgagctgggccgtg
cccaagggaccttcctataatacccgggataagaggctggccgtccaggtggaggaccat
cccctggaatacaggaactttgaggggacgattcccaaaggggaatatggcggcggagtc
gtcatgctctgggatgaagggtactgggaaccggatgggaatgtggacgacgggctccgc
gcagggatgctgaagtttgtgctcaaaggacggaggctgaagggaaagtgggctttggtg
cgcttgaaaaagaaagcgggcgagaccaaggataactggctgctgctgaaagaaaaagat
cagtatgccaaaaccggcgacgaggtttcccagtttgccaccagcatcagaaccggacgc
accatgaaggaaatcgaagaaggggaggacgaaaagatcaccccaaaccccttcggcagt
accggcgtgcagctggccaaattagtgcggatggttcctgaaggggaggattggctctat
gagctgaaatacgacggctacaggatagtggcgtatatggagggcggcagcgcccgcctt
ctgaccaggaatggccgggattatacggcgcggtttccggatgtcgcctcttcccttagc
gattgggccggaggaagggccatgattctggacggcgaaatggccgtcacggatgcagcg
ggcaggacagattttcaggcgctccagaactatctgaacaatgctcaggcccaaagcctg
acctatatcatctttgatctcctggccctggatggggcggacctccggggacaccgcctg
cttgaccggaagggaaccctggaagcgttgctgaaggatgcccctgaaaacctctactac
agccggcatgtgagcggaaacggcagggaaagcttcgctgcggcctgtgccgcaggtctg
gaaggaatcatcggcaaaaaagcggattccctctacagcggaaccagaaacggggactgg
atcaagctgaaatgcgagcaacggcaggaatttgtgatcgggggctataccctttccgcg
aaaaagacgagcggggtcagctccctgctcctgggggtttacgaaggtcagggattggtc
tatgccggccgggccggcacgggcttaagtgaagcgggccggagagagcttgcggaaaaa
tttgcgggcagagagagaacggagcctcctttccggcttccgcccaaggccagggcaaac
gagaaaatcacctggctggagcctgagctggtcgcggaaatcaaatttgccgaatggacc
aaggatgatctgttaaggcaggccagcttcaaaggcctgcggacggacaagaagcctgag
gagatcaaaagggaaaaaacggatggggaaagacagcccccgccgtccgccaaagaaacg
gagagagccatggaagcaaacaccaacagcatcatgatcgaaggaatcaagatcacaaat
ccggacaaggtaatctttaccgaccctgaaaccaccaaaggggatgtggtccggtactac
gcccaggtggcggagcgcatgctgccttatgtgagccgcagggtgctcagcatcgtccgc
tgccctaagggcatcgcccagacctgcttttataaaaagcatcccggccccggcagcaag
ggaatcgtcaccatcccggtcaccaacagcgacggagaaaccgaggaatatttttatata
gagaacacctccggactgattgctgaagcccaaatgggcaccctggaatttcatacctgg
ggaagccgggcggacgagctggaaaagcctgatctgatggtttttgatctggacccggat
gaaggaatggatctgagcagggtgcgccagggtgtgcgggatatgaaagatcttctcacc
gagctttccttgcgggcctacctgaaaaccagcggcggcaaggggtatcatgtggtcgtc
ccgctaaagccctctgtttcctgggaccggttttacgattttgccaggcgggttgccgaa
gtgatggagcagaaatggcctgaccgttacaccagcaatgtgagaaaggccaagcgcgcg
ggcaagatctttatcgactggatgcgcaacggcagaggggcgaccagtattgccccctat
tccctgagagcgagggaagggaccagagtgtccatgcccattgcctgggaggagctggat
acggtggctccggacagtgtcaatatggcggaggcgctgcggcggatcggcggcaatgac
ccctggcagggtttcttccggaacgggcagcagctgaaatga

DBGET integrated database retrieval system