KEGG   Staphylococcus haemolyticus JCSC1435: SH0210Help
Entry
SH0210            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; 3-oxoacyl-(acyl-carrier protein) reductase homolog
Organism
sha  Staphylococcus haemolyticus JCSC1435
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP Epimerase 3HCDH_N GDP_Man_Dehyd RmlD_sub_bind VBS DUF853 F420_oxidored Enoyl_reductase Glyco_hydro_1 UPF0146
Motif
Other DBs
NCBI-ProteinID: BAE03519
NITE: SH0210
UniProt: Q4LA06
LinkDB All DBs
Position
204434..205216
Genome map
AA seq 260 aa AA seqDB search
MTNIIDQFKVNGKVAIVTGGAMGLGKAMAEALAQAGADIVIADIKLDLAQETAKAIADNE
GVKTTALKVDVTNPENVSKMVDDVVNEYGKVDILVNNAGMTINEKAEDVSYENWLKVINL
NLNGVFLVAQAVGRQMIKQGYGSIINTSSMSGLIANKPQEQASYNASKAGVIMLTKSLAM
EWSKYGIKVNTIAPGYMKTALTEPMFNTGGEMIDYWMGATPMGRPGEPEELGGIVVYLAS
DASSFAQGSVFTIDGGYTAL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacattattgatcaatttaaagtaaacggtaaagtagcaatcgtaacaggcggt
gccatgggactaggtaaagctatggcagaagcattagcacaagcaggtgcagatattgtt
attgcagacattaaattagatttagctcaagaaacagcaaaagcaattgcagataatgaa
ggcgtcaaaacgacggcattaaaagtagatgttacaaatccagaaaatgttagcaaaatg
gtagacgacgtcgtgaatgagtacggtaaagttgatatcttagtaaataatgctggtatg
acaattaatgaaaaagcagaagacgtctcttacgaaaactggttaaaagtaattaactta
aacttaaatggtgtcttcttagtagcacaagcagtaggacgtcaaatgataaaacaaggt
tatggttcaatcattaatacatcatcaatgtcaggactaattgccaataaaccacaagaa
caagcatcttacaatgcatctaaagcaggcgttatcatgttaacgaaaagtttagcaatg
gaatggtcaaaatatggcatcaaagtaaacacaattgcaccaggctacatgaaaacagca
ttaactgaaccaatgtttaatactggtggtgaaatgatcgattattggatgggtgcgaca
ccaatgggtcgtccaggtgaaccagaagaattaggtggcattgttgtataccttgcatct
gacgcttcatcattcgcacaaggtagcgtatttacaattgatggtggttacactgcatta
taa

DBGET integrated database retrieval system