KEGG   Staphylococcus haemolyticus JCSC1435: SH0605Help
Entry
SH0605            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; hypothetical protein, similar to L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SH0605
Enzymes [BR:sha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SH0605
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SH0605
    1.1.1.-  
     SH0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C MTS
Motif
Other DBs
NCBI-ProteinID: BAE03914
NITE: SH0605
UniProt: Q4L8W1
LinkDB All DBs
Position
complement(622666..623709)
Genome map
AA seq 347 aa AA seqDB search
MKAAVWYGQKDVRVEDREPKQLKDNEVKVKVSWAGICGTDLHEYLEGPVFISTDKPDPLL
GQKAPVTLGHEFAGVVEEVGKDVTKYKKGDRVVVNPTVSKHEKDESVDLYDGYSFIGLGS
DGGFAEFTNAPEENVYALPESVSDKEGALVEPTAVAVQAVKEGKLLFGDTVAVFGAGPIG
LLTIVAAKAAGASKIFVFDLSEERLAKAKEVGATHVVNSGNTNPVDFINEHTENGVDVTF
EVAGVGVTLSQSVQVTRPRGTVVIVSIFAHAVDFDPMLLTNSGVQLTSTIAYSPTTFQQT
IDLIANGSLDVKSVVTDEIELENIVESGFEQLVNDKSQAKILVKLNG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggtcaaaaagatgttcgcgtggaagatcgtgaacctaag
caattaaaagacaatgaagttaaagtaaaagtttcatgggcaggtatttgcggaactgat
ttacatgaatacttagaaggaccagtcttcatctctacagataaacctgatccactactt
ggacaaaaagcacctgttactttaggtcatgagtttgctggtgttgttgaagaagttggt
aaagacgttactaaatataaaaaaggtgaccgcgtagttgttaacccaactgtatctaaa
cacgagaaagatgaaagcgttgatttatatgatggctattcatttatcggtttaggctct
gatggtggctttgccgaatttacaaatgcgccagaagaaaatgtatatgcattacctgaa
agtgtatctgataaagaaggtgctttagtagaacctactgcagttgcggttcaagcagtt
aaagaaggtaaattattatttggtgatacagtagcagtatttggtgctggcccaattggt
ttattaacaattgttgcagctaaagcagctggtgcaagtaaaatcttcgtatttgattta
tctgaagaacgtttagctaaagctaaagaagtcggcgctacgcatgtagttaactctggt
aatacaaatcctgtagactttattaacgaacatacagaaaatggtgtagatgttacattt
gaagttgctggtgttggtgtaacattatctcaatctgtacaagttacgcgtccaagaggt
acagttgtcatcgtatcaatctttgctcatgcagtagatttcgatccaatgttattaact
aactcaggtgttcaattaacttctacaattgcatactctcctactacattccaacaaaca
attgatttaattgcgaacggtagtttagatgttaagagcgtagtaacagatgaaatcgaa
ttagaaaacattgttgaatctggattcgaacaattagtaaacgataaatctcaagctaaa
attttagttaaattaaatggttaa

DBGET integrated database retrieval system