KEGG   Staphylococcus haemolyticus JCSC1435: SH0913Help
Entry
SH0913            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; hypothetical protein, similar to aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00010  Glycolysis / Gluconeogenesis
sha00071  Fatty acid degradation
sha00280  Valine, leucine and isoleucine degradation
sha00310  Lysine degradation
sha00330  Arginine and proline metabolism
sha00340  Histidine metabolism
sha00380  Tryptophan metabolism
sha00410  beta-Alanine metabolism
sha00561  Glycerolipid metabolism
sha00620  Pyruvate metabolism
sha00625  Chloroalkane and chloroalkene degradation
sha01100  Metabolic pathways
sha01110  Biosynthesis of secondary metabolites
sha01120  Microbial metabolism in diverse environments
sha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SH0913
   00053 Ascorbate and aldarate metabolism
    SH0913
   00620 Pyruvate metabolism
    SH0913
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SH0913
   00561 Glycerolipid metabolism
    SH0913
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SH0913
   00310 Lysine degradation
    SH0913
   00330 Arginine and proline metabolism
    SH0913
   00340 Histidine metabolism
    SH0913
   00380 Tryptophan metabolism
    SH0913
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SH0913
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SH0913
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SH0913
Enzymes [BR:sha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SH0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SIMPL VASP_tetra DUF2884
Motif
Other DBs
NCBI-ProteinID: BAE04222
NITE: SH0913
UniProt: Q4L803
LinkDB All DBs
Position
920597..922027
Genome map
AA seq 476 aa AA seqDB search
MMRNYTQQYINGEWIDSDSNETIEVINPATEEVIGKVAKGNSNDVEKAVEAANNVYLEFR
HSSVKERKELLDKIVEEYKNRKQDIIEAITDELGAPLTLSENVHYQMGLNHFEEASRALD
SFEFEERRGDALVTKEAIGVSGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAA
VILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGRTGSKIMEKASKDF
KKVSLELGGKSPYIVLDDVDVKEAAKATTGKVVNNTGQVCTAGTRILIPESKKEDFLTAL
KEEFSKVKVGDPREEGTQVGPIISKKQFDTVQSYIDKGIEEGAELFYGGPGKPEGLNTGY
FARPTIFINVDNDMTIAQEEIFGPVASVITYNNLDEAIKIANDTKYGLAGYVIGKDKETL
QKVARSIEAGRIEINEAGNQPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYFS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgatgagaaattatactcaacaatatataaatggcgaatggattgatagcgatagtaat
gaaacgattgaagtaatcaatccagcaactgaagaagttattggtaaagtagctaaaggc
aattctaatgatgtggaaaaagcagtagaagctgcaaataacgtttatttagaatttcgt
catagctcagtgaaagaaagaaaagaactattagataaaattgtagaagaatataaaaat
agaaaacaagatattatagaagccataacggatgaattaggtgcacctttaacattatct
gagaatgtccactaccaaatgggactaaatcattttgaagaggcaagtagagcactagat
tctttcgaatttgaagaaagacgtggagatgcattagttactaaagaggcaattggtgtt
tcaggattagtaacaccttggaatttcccaactaatcaaacttcattgaaattggcagcc
gcatttgcagcaggtagtcctgtagttctaaaaccttcagaagaaacaccatttgctgca
gttattttagctgaaatatttgataaagtaggcgtaccaaaaggtgtatttaatcttgtt
aatggtgacggcgaaggtgtaggtaatccactaagtgaacatccaaaagttagaatgatg
tcatttactggttcaggacgcacgggttcaaaaataatggaaaaagcttctaaagatttc
aaaaaagtatcacttgaattaggtggtaaatcaccttatatcgtattagatgatgttgat
gttaaagaagcagcgaaagcaactactggcaaagtagttaataacacaggtcaagtatgt
actgcaggtactcgtattttaattcctgaaagcaaaaaagaagacttcttaactgcactt
aaagaagaatttagtaaagttaaagttggagatccacgagaagaaggtactcaagttgga
ccgattattagtaagaaacaatttgatacagtccaatcatatattgataaaggtattgaa
gaaggtgcagagttattttacggtggtcctggtaaacctgaaggattaaatactggttat
ttcgcgagaccaactatttttatcaatgtagacaatgacatgacaattgctcaagaagaa
atctttggaccagttgcttctgtaatcacatataataatttagatgaagcaatcaaaatt
gctaatgatactaaatatggattagcaggatatgtaataggtaaagataaagaaacactt
caaaaagtagctcgttcaattgaagcaggtagaattgaaatcaatgaagctggcaaccaa
ccagatttaccatttggtggatataaacaatctggaattggtcgtgagtggggcgattat
ggtatagaagaattcttagaagtgaaatcaattgctggttatttcagttaa

DBGET integrated database retrieval system