KEGG   Staphylococcus haemolyticus JCSC1435: SH0954Help
Entry
SH0954            CDS       T00250                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00473  D-Alanine metabolism
sha00550  Peptidoglycan biosynthesis
sha01100  Metabolic pathways
sha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SH0954 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SH0954 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SH0954 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sha01011]
    SH0954 (ddlA)
Enzymes [BR:sha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SH0954 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:sha01011]
 Precursor biosynthesis
  Amino acid ligase
   SH0954 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAE04263
NITE: SH0954
UniProt: Q4L7W2
LinkDB All DBs
Position
955696..956766
Genome map
AA seq 356 aa AA seqDB search
MVKENICIVYGGKSAEHDVSKLTAQNVLNAIDKERYLVDIIYITNDGLWKKKENITEEIK
EIESLNMTDIEAGEITILLKESSNGKPYDAIFPLLHGPNGEDGTIQGLFEVLDLPYVGNG
VLAASSSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEGNIIKLVKDKLTYPVFVKPAN
LGSSVGISKCNNEDELKSGIEEAFQFDRKLVIEQGINAREVEVAVLGNDYPETTWPGEVI
KDVAFYDYKSKYKDGKISLQIPAELDEEVQMTLRNMALEAFKATDCSGLVRADFFVTEDN
QIFINETNAMPGFTAFSMYPSLWENMGLSYSDLITKLIDLAKERHEDKKKNKYTID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaaaacatttgtatcgtatatggtggtaaaagtgctgaacatgatgtttct
aaattgactgcgcaaaatgttcttaatgcaattgataaagaaagatatttagtggatatc
atttatattacgaatgatggcttatggaagaaaaaagaaaatatcactgaggaaattaaa
gaaattgaatccctaaatatgacagatatagaagcgggcgaaatcactattttgcttaaa
gaaagtagcaatggtaaaccttatgatgcaatattcccattacttcatggccctaatggt
gaagatggtacaattcaagggttatttgaagttcttgatttaccatatgttggaaacggt
gtactagctgcatcaagttcaatggataaacttgtcatgaaacaattatttgaacataga
ggattgcctcaattaccttacattagtttcttaagaagtgaatatgaaaaatatgagggg
aatattattaaactcgttaaagataaacttacatatccagtattcgtaaaacctgcaaat
cttggctcaagtgtaggtattagtaaatgtaataatgaggatgaactaaaatcaggtatt
gaggaagctttccaatttgaccgtaaactcgttattgagcaaggtattaatgctcgcgaa
gttgaagtagctgtattgggcaatgactatcctgaaacaacatggccaggagaagttatc
aaagatgttgcattctatgattacaaatcaaaatacaaagacggtaaaatcagtttacaa
attcctgcagaattagatgaagaagtgcaaatgacattaagaaacatggcattggaagca
tttaaagctacagattgttcgggattagtacgtgcggatttctttgttactgaagacaat
caaatttttattaatgaaacaaatgcaatgcctggatttacagcatttagtatgtatcca
agtttatgggagaatatggggttatcttattctgacctaatcacaaaattaattgaccta
gctaaagaacgtcacgaggataaaaagaaaaacaaatacacaattgactaa

DBGET integrated database retrieval system