KEGG   Staphylococcus haemolyticus JCSC1435: SH1608Help
Entry
SH1608            CDS       T00250                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00564  Glycerophospholipid metabolism
sha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SH1608 (glpD)
Enzymes [BR:sha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SH1608 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 Pyr_redox FAD_oxidored GIDA NAD_binding_8 Thi4 GMC_oxred_N 3HCDH_N HI0933_like Lycopene_cycl K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAE04917
NITE: SH1608
UniProt: Q4L608
LinkDB All DBs
Position
complement(1650300..1651973)
Genome map
AA seq 557 aa AA seqDB search
MALSTLNREVIKKNLQNEEYDVVIIGGGITGAGIALDASQRGMKVALVEMQDFAQGTSSR
STKLVHGGLRYLKQAQIKVVAETGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFTTNL
GLTAYDRLAGVKKYERKKMLSKKQTLNKEPLVKKDGLKGGGYYVEYRTDDARLTIEVMKR
AEENGAEILNHTKSTDFIYDSKSKVRGIEVQDLLTGEMYEINAKKVINAAGPWVDEVRKK
DYTRNNKQLRLTKGVHVVIDQSKFPLRQAVYFDTEKDGRMIFAIPREGKAYVGTTDTFYD
NDKTKPLTTQEDRDYLIDAINYMFPDVNVKDEDIESTWAGVRPLILEDGKDPSEISRKDE
IWEGKSGLLTIAGGKLTGYRHMALEIVDLLAKRLKQEYKLTFAECKTKHTPISGGDVGGS
ANFESFVERKVEEGKAIGLQADVAKRLASKYGSNVDKLYNIAQIAQDKDLKLPLELYVEL
VYSVQNEMVFKPTDFLIRRSGKLYFNINEVKQYKDAVVEELAKLLNYTQSQQNEFTKEIN
IAIEEATRGNEQLAVLK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggctttatcaacattaaacagagaagtaattaagaaaaatttacaaaatgaagaatac
gatgtcgttattatcggtggtggtattacaggtgcaggtattgcattagatgcgtctcaa
cgaggaatgaaagtagctttagtagaaatgcaagattttgctcaaggtacaagttcccgt
tctactaaacttgttcacggtggtttaagatatttaaaacaagctcaaatcaaagttgta
gctgaaacgggtaaagaacgtgcgattgtttatgaaaatggccctcatgtaactactcct
gaatggatgttattaccaatgcacaaaggcggaacgtttggtaaattcacaactaactta
ggtttaactgcttatgaccgtttagcaggcgtaaaaaaatatgaacgcaagaaaatgtta
agcaaaaaacaaacattaaacaaagagccattggttaaaaaagatggacttaaaggtggc
ggttattacgttgaataccgtactgatgatgcacgtttaacaattgaagttatgaaacgt
gctgaagaaaatggtgcagaaattttaaatcacacgaaatctacagatttcatttacgat
tctaaatcaaaagtaagaggtattgaagttcaagatctacttactggtgaaatgtatgaa
attaacgctaaaaaagttattaatgcagcaggcccttgggtagatgaagttcgtaaaaaa
gattatacacgtaacaataaacaattacgtttaactaaaggtgtccatgtagtcattgat
caatctaagtttccattaagacaagctgtttattttgacactgaaaaagatggtagaatg
atctttgcaattccacgtgaaggtaaagcatacgttggaactacagatactttctatgat
aatgacaaaacaaaacctttaacaacacaggaagatagagattatctaattgatgcgatt
aactatatgttcccagatgttaatgtgaaagatgaagatatcgaatcaacttgggcagga
gttagacctttaattttagaagatggaaaagacccttctgaaatttcacgtaaagatgaa
atttgggaaggtaaatcaggcttattaacaatcgctggtggtaaattaacaggttatcgt
catatggcgcttgaaatcgtagatttattagctaagcgcttgaaacaagaatataaattg
acatttgctgaatgtaaaacaaaacatacaccaatttctggtggtgatgtaggtggtagc
gctaactttgaaagtttcgtggaacgcaaagttgaagaaggtaaagcgatcggacttcaa
gccgatgttgccaaacgtttagcttctaaatatggttctaacgtagataaactatataac
atcgcacaaattgcacaagataaagatttaaaattacctttagaattgtacgttgagtta
gtatatagtgtacaaaatgaaatggtgtttaaaccaactgatttcttaattcgtagatct
ggtaaactttatttcaatatcaatgaagttaaacaatataaagatgcagtcgttgaagaa
cttgctaaattactaaactatacacaaagtcaacaaaacgaattcactaaagaaattaat
attgcaattgaagaagcgactcgtggaaatgaacaacttgcagtattaaaataa

DBGET integrated database retrieval system