KEGG   Staphylococcus haemolyticus JCSC1435: SH1695Help
Entry
SH1695            CDS       T00250                                 

Definition
(GenBank) unnamed protein product; hypothetical protein, similar to protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Brite
KEGG Orthology (KO) [BR:sha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sha01001]
    SH1695
Enzymes [BR:sha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SH1695
Protein kinases [BR:sha01001]
 Serine/threonine kinases: Other
  Bacterial family
   SH1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: BAE05004
NITE: SH1695
UniProt: Q4L5S1
LinkDB All DBs
Position
complement(1753603..1755630)
Genome map
AA seq 675 aa AA seqDB search
MIGKIVSERYKIVDKLGGGGMSTVYLAEDTILNREVAIKAISIPQNEKEETMKRFEREVN
NATQLSHENIVEVYDVQEDEECFFLIMEYIDGPTLSEYIHSHGPLSVDTAIDFTNQILKG
VAQAHEKLIIHRDIKPQNILIDKNKTLKIFDFGIAKALSETSMTQTNHVLGTVQYLSPEQ
AKGETTNEATDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSIPNVTELRSEIPQSL
SNVVLRATEKKASDRYQSVKDMKEDLSSVLVSSRANEKKHSIEEDETNTVSIDRQDIKSK
IKEENEQKQIAQTMQIPIVNEHHFQTSEAQIYEPPKKKRSKKKKFAIALILLLLVASLFG
FIAMGMFGSKYAEVPDLKGKTEKEAEKILRQSHLEIGNISRDYSDDYPENKIIKTKPKQG
ERVNQHEKVDIVLSKGPERAKMPNVIGMKKVDALDKLKQSKLDHVTVNQEYNNQVPKGAI
AKQSVNPDSYVRINDHQITLTESLGVKKVYVKNYENKNYQTAKKELEKNGLKVQMTTESS
NNVKKDNIISQSPKNTEVEEGSTVQFIVSKGKTSSKDEDKDSEKSKSSSEDKSDDTQKVK
NYTETYHIPYTGDDESQKVQVYIRDKDNSGTSASQTFSIKDDKTITIPLKIEQGSDAGYT
IRVDGDVIADKDIEY
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgattggaaagatagttagtgaacgttacaaaatagtagataagcttggtggcgggggt
atgagtaccgtttacttagcagaagataccattttaaatcgtgaagtagcgattaaagca
atctctattcctcagaatgaaaaagaagaaacgatgaagcgtttcgaacgagaagttaac
aatgcgacacaactttcacatgaaaacattgttgaagtatatgatgttcaagaagatgaa
gagtgcttctttctaattatggaatatatagatggacctactttatcagaatatatacat
agccatggacctttaagtgtagatacagccattgatttcacgaatcagattttaaaaggt
gtggcacaagcgcatgaaaaacttatcatacatagagatataaaacctcagaacatttta
attgataagaacaaaacactaaaaatctttgactttggaattgcaaaggcgttaagtgaa
acatctatgacacagacgaatcatgtattaggaacagttcagtatctttcaccagaacaa
gctaaaggtgaaactacgaatgaagcaactgatatctattccatcggtatcgttctttac
gaaatgttagttggtgaaccgccttttaatggtgagacagccgttagtatcgcaataaaa
catattcaagattcaattccaaacgtaacggagttaagatctgaaatacctcaatcacta
agtaatgtcgtacttagagcaacggagaagaaagcctctgatcgctatcaaagtgttaaa
gatatgaaagaagatttaagtagtgtgcttgtgtctagtcgtgctaatgaaaagaagcat
tctattgaagaagatgagactaatacggtatcgattgatagacaagatattaaaagtaaa
ataaaagaagaaaatgaacaaaaacaaattgcacaaacgatgcaaataccgattgttaat
gagcatcattttcaaacgagcgaagcacaaatctatgaaccacctaagaaaaaacgttca
aaaaagaagaaattcgctattgcgcttattttacttttattagtcgcaagtttatttggt
tttatagcgatgggcatgtttggtagtaaatatgcggaagtgcctgatcttaaaggtaaa
actgaaaaagaagcggaaaaaatactgcgacaatctcatttagaaattggtaatatctct
agagattacagtgatgattatccggaaaataaaataataaagactaaaccaaaacaaggt
gaaagagttaatcagcatgaaaaagtagatattgtgctttcaaaagggcctgaacgtgct
aaaatgcctaatgttataggcatgaaaaaagtagatgcattagataaattgaaacaatct
aaacttgatcatgtgacagtcaatcaagaatataataatcaagtacctaaaggtgctata
gctaagcaaagtgttaatcctgatagttatgttcgcataaacgatcatcaaattacttta
accgaatcattaggtgttaaaaaggtatatgttaaaaattatgaaaataaaaattatcaa
actgcaaagaaagaacttgaaaaaaatggtctgaaagtacaaatgacgacagaatcaagt
aataatgttaaaaaagataatattatttcacaaagccctaaaaatacagaggttgaagag
ggaagtacagttcaattcattgtttcaaaaggaaaaacatcttcaaaagatgaagacaaa
gattcagagaaatctaaatcttctagtgaagacaagtctgatgatacacaaaaagttaag
aattatacagaaacatatcacatcccatatacgggagatgacgaaagtcaaaaagttcaa
gtttacattagagataaggacaatagtggcacatctgctagccaaacgtttagtataaaa
gatgacaaaacgataacgattccgcttaaaattgagcaaggctcagacgcgggctataca
atcagagttgatggcgatgtaattgcagataaagatatagaatattaa

DBGET integrated database retrieval system