KEGG   Staphylococcus haemolyticus JCSC1435: SH1947Help
Entry
SH1947            CDS       T00250                                 

Gene name
fabI
Definition
(GenBank) trans-2-enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sha  Staphylococcus haemolyticus JCSC1435
Pathway
sha00061  Fatty acid biosynthesis
sha00780  Biotin metabolism
sha01100  Metabolic pathways
sha01130  Biosynthesis of antibiotics
sha01212  Fatty acid metabolism
Module
sha_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SH1947 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SH1947 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SH1947 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sha01004]
    SH1947 (fabI)
Enzymes [BR:sha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SH1947 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SH1947 (fabI)
Lipid biosynthesis proteins [BR:sha01004]
 Fatty acid synthase
  Component type
   SH1947 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR PALP
Motif
Other DBs
NCBI-ProteinID: BAE05256
NITE: SH1947
UniProt: Q4L519
LinkDB All DBs
Position
complement(1995121..1995891)
Genome map
AA seq 256 aa AA seqDB search
MINLENKTFVIMGIANKRSIGFGVAKVLDQLGAKLVFTYRKDRSRKELEKLLEQLNQEEP
KLYQIDVQKDEDVVNGFAKIGEEVGNIDGVYHSIAFANIEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKIMPNGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLAYDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLRRNVDQEEVGKTAAYLLSDFSSG
VTGENIHVDSGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcttgaaaataaaaccttcgtaattatgggtattgctaataaacgtagtatc
ggatttggcgttgcaaaggtattagatcaattaggggctaaacttgttttcacttatcgt
aaagaccgtagccgcaaagaattagaaaaattattagaacaattaaaccaagaagagcca
aaattatatcaaatcgatgttcaaaaagatgaagatgtagtaaatggtttcgctaaaatt
ggcgaagaagtaggcaatattgatggcgtatatcactctatcgcatttgcaaatattgaa
gacttacgtggacgtttctctgaaacatcacgtgaaggtttcttacttgcgcaagatatc
agttcatattcattaacaattgttgcgcacgaagcgaagaaaataatgccaaacggtggt
agtattgttgcaacaacataccttggtggtgaatttgccgttcaaaactataatgtgatg
ggtgtagctaaagcaagtttagaagctaatgttaaatatttagcttatgatttaggcccg
gacaacattcgagtaaatgctatttctgctggtccaattcgtacgttaagtgctaaaggt
gttggtggtttcaacacaatccttaaagaaattgaagaacgtgcaccattaagacgaaat
gtggatcaagaagaagtaggtaaaacagctgcttacttattgagtgatttctcaagtggc
gtaactggtgagaatatccatgtagatagtggtttccacgcaataaaataa

DBGET integrated database retrieval system