KEGG   Sulfurospirillum halorespirans: SHALO_0471Help
Entry
SHALO_0471        CDS       T04475                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
shal  Sulfurospirillum halorespirans
Brite
KEGG Orthology (KO) [BR:shal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:shal03012]
    SHALO_0471
   03029 Mitochondrial biogenesis [BR:shal03029]
    SHALO_0471
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shal04147]
    SHALO_0471
Translation factors [BR:shal03012]
 Eukaryotic Type
  Elongation factors
   SHALO_0471
 Prokaryotic Type
   SHALO_0471
Mitochondrial biogenesis [BR:shal03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SHALO_0471
Exosome [BR:shal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SHALO_0471
  Exosomal proteins of breast cancer cells
   SHALO_0471
  Exosomal proteins of colorectal cancer cells
   SHALO_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AOO64263
UniProt: A0A1D7TH00
LinkDB All DBs
Position
476983..478182
Genome map
AA seq 399 aa AA seqDB search
MAKEKFSRTKPHVNIGTIGHVDHGKTTLTAAISAVLATKGLCEFKDYDGIDNAPEERERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDEELLELVEMEIRELLSVYDFPGDDTPIIAGSALKALE
EAKVGTVGAWGQKILDLMAAVDDYIPNPVRETDKDFLMPIEDVFSISGRGTVVTGKIDRG
AVKIGETIEIVGIKDTKTTTVTGVEMFRKEMERGEAGDNCGILLRGIKKEDVERGMVLCK
PKSITPHTDFEAEIYVLSKEEGGRHTPFFNNYRPQFYVRTTDVTGSITLPEGTEMVMPGD
NVKIKVAMIAPIALEEGTRFAIREGGRTVGAGVVSTIIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagttctctagaaccaagccacacgttaacattggaaccatcggtcac
gttgatcatggtaaaactacgcttacagctgcgatctcagcagttctagcgacaaaaggt
ctttgtgaatttaaagattacgatggtattgataacgctcctgaagagagagagcgtggt
attactattgcaacttctcacattgaatatgaaacagaaaaccgtcactatgcacacgta
gattgtccaggacatgctgattatgttaaaaacatgattacaggtgctgctcaaatggat
ggcgcgattcttgttgtttctgcagcagatggtcctatgccacaaacgcgtgagcacatt
cttctttctcgccaagtaggcgttccatatatcgttgttttcatgaacaaagcggatatg
gttgatgatgaagaacttcttgagcttgttgaaatggaaatccgtgaacttctttctgtt
tatgacttcccaggtgatgacactccaatcattgcaggttctgcgcttaaagcacttgaa
gaagcaaaagttggtactgttggtgcatggggtcaaaaaattcttgatcttatggcagca
gttgatgattatattccaaacccagttcgtgaaacggataaagacttcttgatgccaatc
gaagacgtattctcaatctcaggtcgtggtaccgttgttactggtaaaatcgacagaggc
gctgttaaaatcggtgagactatcgaaatcgtaggtatcaaagatactaaaacaacaacg
gtaaccggtgttgaaatgttccgtaaagagatggagcgtggtgaggctggtgataactgc
ggtatcttacttcgtggtatcaaaaaagaagacgttgagcgtggtatggttctttgtaaa
ccaaaatcaatcactccacacactgactttgaagctgagatctatgttctttcaaaagaa
gagggtggccgtcatactccattctttaacaactatagaccacaattctatgttcgtaca
acagacgtaacaggttctatcacattaccagaaggtactgagatggttatgcctggtgat
aacgtaaaaatcaaagtagcaatgatcgctcctatcgctcttgaagagggtactcgtttt
gcaatccgtgagggtggtagaactgttggtgcgggtgttgtttcaacaatcatcaagtaa

DBGET integrated database retrieval system