KEGG   Sulfurospirillum halorespirans: SHALO_0522Help
Entry
SHALO_0522        CDS       T04475                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shal  Sulfurospirillum halorespirans
Brite
Enzymes [BR:shal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SHALO_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOO64312
UniProt: A0A1D7TH19
LinkDB All DBs
Position
531219..531815
Genome map
AA seq 198 aa AA seqDB search
MAITLPALPYEANALEPHISANTLGFHHGKHHQTYVTNLNNLIQGTELAEESLEKIILAV
ANKPEKVGIFNNAAQVWNHTFYWNCMKKGGGGAPSGAIATKITEDFGSFEAFVEAFKSAG
LTQFGSGWAWLVLEGGKLKITKTANADTPLAHDQKAILTVDVWEHAYYLDYQNKRADYLD
VFLKSLVNWDFANANLKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctattactttaccggcacttccttacgaagctaacgcactagaacctcacatctca
gccaatacccttggatttcatcatggaaagcatcatcaaacttatgttaccaatctgaac
aatcttatccaaggcactgaacttgccgaggagagtcttgaaaagatcattttagcggtt
gccaataaacctgaaaaagtgggtatttttaacaatgccgctcaagtttggaaccatacg
ttttactggaactgtatgaaaaaaggcggcggtggcgctccaagtggcgcgattgcgact
aaaatcaccgaagattttggaagttttgaagcctttgtcgaagcgtttaaaagcgctgga
ctcacacaatttggtagcggttgggcctggcttgtgcttgagggtggaaaactgaaaatc
accaaaacagccaatgctgacacacctcttgcacacgatcaaaaagcgattttaaccgtt
gatgtttgggagcatgcgtattatctggattatcaaaacaaacgtgctgattatttggat
gttttcttgaaaagtcttgtcaattgggattttgctaacgcgaatttaaaagcataa

DBGET integrated database retrieval system