KEGG   Streptomyces hawaiiensis: CEB94_04710
Entry
CEB94_04710       CDS       T06917                                 

Definition
(GenBank) erythromycin biosynthesis sensory transduction protein eryC1
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
shaw  Streptomyces hawaiiensis
Pathway
shaw00523  Polyketide sugar unit biosynthesis
shaw01100  Metabolic pathways
shaw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shaw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CEB94_04710
Enzymes [BR:shaw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     CEB94_04710
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: QCD54234
UniProt: A0A6G5R8L6
LinkDB
Position
complement(989865..991211)
AA seq 448 aa
MMGAVAVAHARPSRPASQRTSNTPGQPPPHTATTTPPSVSYATNRLDSLLSHCHSRAIFQ
HSVPQCGTEARLPMRVALYDHAKLYREHREAIDAAIARVLESGQFTWGEQVPAFEEEFAS
WVDARHAVAMGSGTAALTTALRALEIGPGDEVITVANTELTGIAAISAVGATVVWVDIDP
ESRCIDTTACEAAITPRTRALLPVDMYGHPADMIEMRRIADRHGLALVEDACIALGAEID
GRRLGSHADVTCFSFSPGKHLGAMGAAGACTTQNAALADRIHKLASDGQARGRHYDPKPR
IGQHHETEGHNQRMDEMQAAILRAKLPHLDETLAVRRAHADRYTERLVGLADLPGERTGF
RHAWRNYVIELDRRDELAAHLFAHGIGCNALYSPPMHLQPVYRGLGYAVGSLPRTERSGK
RLLGLPLGPPLSLEQIDIVADEVHAGLA
NT seq 1347 nt   +upstreamnt  +downstreamnt
gtgatgggcgcggtagctgtcgcgcacgctcgaccctctcgccccgcctctcaacgaacc
agcaacacaccaggtcagccgccaccccatacggcaaccaccactcctccgagcgtcagc
tacgcgacgaaccgccttgactccctcctgagccactgccattctcgtgccatatttcag
catagcgttccacaatgtggaacggaagcgaggttgcccatgagagtcgcgctctacgat
cacgccaagctctatcgtgagcaccgtgaggcaatcgatgccgctatcgcccgagtgctt
gaaagcggacagttcacttggggtgagcaagtgccagctttcgaggaggaattcgcaagt
tgggtcgacgcgcggcatgcggtcgccatgggctcgggtacggccgccctgacgaccgcg
ctacgcgcgctcgagatcggaccgggagacgaagtcatcacggttgcaaataccgagctc
accggaatagcggcgatcagcgcggtcggtgcaaccgtcgtctgggtcgacatcgacccc
gagtcacgatgcatcgacacaaccgcatgcgaagccgcgatcacgccacggacacgcgcc
ctgttgcctgtcgacatgtacggccatcccgccgacatgatcgagatgcgccgcatcgcc
gatcgccatggtcttgcactcgtcgaggatgcctgtatcgcgctcggcgcagagatcgac
ggcaggaggctcggcagccatgccgacgtcacctgcttcagcttctcccctggaaaacac
cttggcgccatgggagccgcaggcgcctgcacgacacagaatgccgctttggcagaccgg
atccacaagcttgcgtccgacggtcaggctcgtggacggcactacgacccgaagccaagg
atcggccagcaccacgagacggagggccataaccagcggatggacgagatgcaggcggcc
atccttcgcgcgaagctgccccatctcgacgagacgctggccgtgcggcgcgctcatgcc
gaccgctataccgagcgtctcgtcggcctggccgatctgcctggagaaaggacgggcttc
cgacatgcttggcgcaactatgtcatcgagctcgatcgaagagatgagctggccgctcac
ctcttcgctcatggaattggctgcaacgccctctactctccgccaatgcatcttcagccg
gtctacagaggtctcggatacgctgtcggcagcctgcccaggacggagcgttcaggcaaa
cggcttcttggcctgccgctcggaccgcccctgagccttgagcagatcgacatcgtcgcc
gacgaggtccacgccggattggcctga

DBGET integrated database retrieval system