KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_01589Help
Entry
SU5_01589         CDS       T02011                                 

Definition
(GenBank) Cell division protein FtsK
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
KEGG Orthology (KO) [BR:shb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shb03036]
    SU5_01589
Chromosome and associated proteins [BR:shb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    SU5_01589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE FtsK_4TM FtsK_alpha FtsK_gamma AAA_10 DUF87 T2SSE TrwB_AAD_bind Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AFH44951
LinkDB All DBs
Position
1774026..1778108
Genome map
AA seq 1360 aa AA seqDB search
MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPI
HNLGGAPGAWLADTLFFIFGVMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVL
ALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHSSGGTIMLLCIWAAGLTLFTG
WSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDEEYDDEYDEETDGVQRESRRARILRG
ALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQP
EYDEYDPLLNGHSVTEPVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQP
VPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQQPVPVASAPQYAATPATAAEYDSL
APQETQPQWQAPDAEQHWQPEPTHQPEPVYQPEPIAAEPSHMPPPVIEQPVATEPEPDTE
ETRPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKPTVSVAPSIPPVEAVA
AAASLDAGIKSGALAAGAAAAAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRRELA
SYGIKLPSQRIAEEKAREAERNQYETGVQLTDEEIDAMHQDELARQFAQSQQHRYGETYQ
HDTQQAEDDDTAAEAELARQFAASQQQRYSGEQPAGAQPFSLDDLDFSPMKVLVDEGPHE
PLFTPGVMPESTPVQQPVAPQPQPQYQQSQQPVAPQPQYQQPQQPVAPQPQYQPPQQPTA
PQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQP
QQPTAPQDSLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVE
ARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIP
GKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPVVADLAKMPHLLV
AGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDA
ANALRWSVNEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHPV
LEKLPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIK
ANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRVHGAFVRDQEVHA
VVQDWKARGRPQYVDGITSDSESEGGGGGFDGGEELDALFDQAVNFVTQKRKASISGVQR
QFRIGYNRAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
ttgagccaggaatatactgaagacaaagacgtcacattgacgaagttaagcagcgggcgc
cgacttttggaagcgttgttgatacttattgccctttttgccgtctggttgatggcggcc
ttgttgagctttaacccttcggaccccagttggtcgcaaaccgcctggcatgaacccatc
cataatttaggcggcgcgccgggcgcgtggctggccgatacactgttctttatttttggc
gtaatggcctacaccatccctgtcattattgtcggcgggtgttggtttgcgtggcgtcat
cagtctacggatgattacatcgactattttgctgtgtcgctacgccttatcggcgtgctg
gcgctgattctcacttcctgcggtctggcggccattaatgccgacgatatctggtatttc
gcctccggcggcgtaattggcagcctgttaagcaccacgctgcagccgttgttgcatagt
agcggcggaacgataatgcttctctgtatttgggctgccgggctgacgctctttaccggc
tggtcctgggtcagtatcgccgaaaaattaggcggctggctgcttaatatactgaccttc
gccagcaaccgtacccggcgtgatgatacgtgggttgacgacgaagagtatgatgacgaa
tacgatgaagaaaccgacggcgtgcagcgtgaatctcgccgggcgcgtattttgcgcggc
gcgttggcgcgtcgtaagcgactggctgaaaaattcagcaatccacggggccgtcagacc
gatgccgcgctcttttccggcaaacggatggatgatgacgaggacattcagtatagcgcg
cgcggcgtcgctgccgatcccgacgacgttctgttttcgggcaaccgtgcgacgcagccg
gaatatgatgaatatgatccgctgttaaacggccattctgtcaccgaaccggtcgccgcc
gctgcggctgcaaccgccgtcacccagacgtgggcagcgtccgccgatcccataatgcaa
acgccgcccatgccgggggctgagccggttgtcgcgcaaccgaccgtggagtggcagccc
gtaccgggaccgcaaaccggcgaaccggttatcgcgcctgcgccggaggggtatcagccg
catccgcaatatgctcaaccgcaagaggcgcaaagtgcgccgtggcagcaacctgtgcct
gtcgcttccgcgccgcaatacgccgcgacgccagcgaccgcagcagaatatgactctctt
gcgccgcaggaaacacagccgcaatggcaggcgccggatgccgaacaacactggcagccg
gagccgacccatcagccggagccggtttatcagccggagccgatagcggctgaaccttcc
catatgccgccgccggttatcgaacagccggttgccaccgagcctgaacctgacacagaa
gagaccagacccgcccgtcctccgctttactattttgaagaggtggaagagaaacgcgcc
cgtgagcgcgaacaactggcggcatggtatcaaccgattccggagccggtaaaagagaac
gtgccggtcaaacctacggtatctgtcgcgccgtccataccgccagtggaagcggtagcc
gccgccgcgtcgcttgacgcaggtattaagagtggcgccctggcagcaggcgccgcggcc
gctgcgcctgcatttagtctggctaccggcggcgcgccgcgtccgcaggtgaaagagggg
attggtccgcaactgccgcgtccgaaccgcgttcgcgtgccgacccgacgggaactggca
tcgtacggtattaagctgccgtcacagaggattgcagaagaaaaagcccgcgaggcggag
cgcaatcagtacgagacgggcgtgcagctaaccgatgaagaaatagatgcaatgcatcag
gacgagttagcccgtcagtttgcgcagtcgcagcagcatcgttatggtgagacgtatcag
cacgatactcaacaggcagaagatgacgataccgctgcggaagctgaattagcccgccag
tttgccgcttcgcaacagcagcgctattccggcgagcaacccgctggcgcgcagccgttc
tcactggacgatctggatttctcgccaatgaaagtattggttgatgaaggtccgcacgaa
ccgctgttcacgccgggtgtcatgcccgagtcaacgcctgttcagcaaccggtagcgccg
cagcctcagccacagtaccagcagtcgcaacagccggtagcgccgcaaccgcagtatcag
cagccgcaacagccggtagcgccgcagccgcagtatcagccgccgcagcaaccgacagcg
ccacagccgcagtatcagcagccgcaacagccggtagcgccgcagccacagtatcagcag
ccgcaacagccggtagcgccgcagccgcagtatcagcagccgcaacagccggtagcgccg
cagccgcagtatcagcagccgcaacagccggtagcgccgcaaccgcagtatcagcagccg
caacagccgacagcgccgcaagacagcctgatccacccgctgttgatgcgtaacggcgac
agtcgtccattacagcgtccgacgacgccgctgccttcgttagatcttctgacgccgccg
ccgagcgaagttgaaccggtagatacctttgcgctggaacaaatggcgcgtctggttgaa
gcgcgtctggcggatttccgcattaaagctgatgtggtgaactattcgccaggcccggtc
attactcgctttgaactgaatctggccccgggcgttaaagcggcgcgtatctccaacctt
tcccgggatctggcgcgctccttgtcaacggtagccgtacgtgttgtggaagtcattcca
ggcaaaccttacgtagggttggaattgccgaacaagaaacggcaaaccgtttatctgcgc
gaagtgttggataacgccaaattccgcgagaatccgtcgccgcttaccgtggtgttaggt
aaggatatcgcgggcgatccggtagtagcggatctggcgaaaatgcctcacctgctggtg
gccggtacgaccggttccggtaagtcggtcggggttaacgccatgatcctcagtatgctg
tataaagcgcagccggaagacgttcgctttatcatgatcgacccgaaaatgttagaactc
tcggtctatgaaggtataccgcatctgctgacggaagttgttaccgacatgaaagacgcg
gctaacgcgttacgctggagcgtcaatgagatggagcgtcgctataagctgatgtccgcg
ctcggcgtgcgtaatctggctgggtataacgagaaaatcgccgaagcggcccgcatggga
cgcccgattccggacccgtactggaagccgggcgacagtatggatgttcagcatccggtt
ctggaaaaactcccgtatatcgtggtactggttgatgaatttgccgacctgatgatgacc
gtcggtaaaaaagttgaagagctgatcgcgcgtctggcgcagaaagcgcgcgccgcgggg
attcacctggtactggcgacgcagcgtccgtcggtcgatgtgattactggtttaattaaa
gccaacattccaacccgtatcgcttttaccgtatccagcaagatcgactcccgcaccatt
cttgatcagggtggcgctgagtcgctattgggaatgggggacatgctctattccggacca
aactccaccatgccggtacgtgtccatggggcgtttgtgcgtgaccaggaagtccatgcg
gtggtgcaggactggaaagcgcgcggtcgtccgcaatatgtggatggcattacctccgac
agcgaaagcgaaggtggcggtggcggttttgacggcggcgaagaattagatgcgctattc
gatcaggccgttaatttcgtcacccagaagcgtaaagcgtccatttccggcgttcagcgt
cagttccgcatcggctataaccgtgcggcgcgtattatcgaacagatggaagcgcagggt
attgtcagcgctcaggggcataacggtaatcgtgaagtgctggctccgccgccttttgag
taa

DBGET integrated database retrieval system