KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0322Help
Entry
SU5_0322          CDS       T02011                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00473  D-Alanine metabolism
shb01100  Metabolic pathways
shb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SU5_0322
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SU5_0322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shb01011]
    SU5_0322
Enzymes [BR:shb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SU5_0322
Peptidoglycan biosynthesis and degradation proteins [BR:shb01011]
 Precursor biosynthesis
  Racemase
   SU5_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFH43699
LinkDB All DBs
Position
368983..370062
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDIFNA
FCQGKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaacagtcgtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcctgccagtaagctggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgctgacgcttttggcgtggcgcgtctt
gaagaggctctacgtctgcgagcgggcgggatcacgcagcctatcctgctgctggagggt
tttttcgacgccgccgatctgccgaccatttccgcgcaatgtctgcataccgccgtacat
aatcaggagcagcttgccgccctggaggcggtggagctggcggagccggtaacggtctgg
atgaaactggataccggtatgcatcgtctcggcgtgcgtcccgaagaggcggaggcgttc
taccagcgtctgacgcactgtaaaaatgtacgccagccggtgaatatcgtcagccatttt
gcccgtgcggatgagccggaatgcggcgctaccgaacatcagctcgacatttttaatgcc
ttctgtcagggtaaacccggtcagcgctctattgccgcgtctggcggtatcctgctgtgg
ccgcagtctcactttgactgggcgcgtccgggcatcattttgtatggcgtatcgccgctg
gagcacaaaccctgggggccggattttggttttcagccggtgatgtccttaacctccagt
ttgatcgcggtgcgtgaccacaaagcgggcgaaccggtgggctacggcgggacatgggtg
agtgagcgcgacacgcgcctgggcgtggtggcgatgggttatggcgatggctacccacga
gcggcgccttccggtacgccagtactggtcaatggtcgtgaagttccgattgtcgggcgg
gtggcgatggatatgatttgcgtagatttggggccaaacgcgcaggataacgcgggcgat
ccggtggtcttatggggtgaaggtctgccggttgaacgtatcgctgaaatgacaaaagta
agtgcttacgaacttatcacgcgcctgacctcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system