KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_03299Help
Entry
SU5_03299         CDS       T02011                                 

Definition
(GenBank) Multidrug resistance protein A
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
KEGG Orthology (KO) [BR:shb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shb02000]
    SU5_03299
Transporters [BR:shb02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   SU5_03299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 HlyD_3 Biotin_lipoyl_2 Orf78 Biotin_lipoyl DUF2776
Motif
Other DBs
NCBI-ProteinID: AFH46630
LinkDB All DBs
Position
3625883..3627055
Genome map
AA seq 390 aa AA seqDB search
MSANAEIQTPQQPAKKKGKRKTALLLLTLLFVIIAVAYGIYWFLVLRHIEETDDAYVAGN
QVQIMAQVSGSVTKVWADNTDFVKEGDVLVTLDQTDAKQAFERAKTALASSVRQTHQLMI
NSKQLQANIDVQKTALAQAQSDLNRRVPLGNANLIGREELQHARDAVASAQAQLDVAIQQ
YNANQAMILNSNLEDQPAVQQAATEVRNAWLALERTRIVSPMTGYVSRRAVQPGAQISPT
TPLMAVVPATDLWVDANFKETQLANMRIGQPVTVITDIYGDDVKYTGKVVGLDMGTGSAF
SLLPAQNATGNWIKVVQRLPVRVELDARQLEQHPLRIGLSTLVTVDTANRDGQVLASQVR
TTPVAESNAREINLAPVNKLIDDIVQANAG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaatgcggagatccaaaccccgcagcaaccggctaagaagaaaggcaaacgc
aaaacagcgctgctacttcttaccttgctctttgttattattgccgtggcatatggaatt
tattggtttttagtattgcgtcatattgaagagacagatgatgcttacgtggcagggaac
caggttcaaatcatggcgcaggtgtcaggcagcgtgacgaaagtctgggctgataacacc
gactttgtaaaagagggcgatgttctggtcacgctcgatcagactgacgccaaacaagcg
tttgaaagagccaaaacggcgctggcctccagcgtgcgccaaacgcaccagttgatgatt
aacagtaagcagttgcaggcgaatatcgacgtgcaaaaaaccgccctggcgcaagcgcaa
agcgaccttaaccgtcgtgtgccgctgggtaatgccaatcttattggccgggaagagctg
caacacgcccgcgatgccgtcgccagcgcgcaggcacagctggatgtcgccattcaacag
tacaatgccaaccaggcaatgatactcaacagtaatctggaagatcagcccgcggttcaa
caagcggcgaccgaagtgcgtaacgcctggctggcgctggagcgtactcgcatcgtcagc
ccaatgactggttatgtctcccgccgcgccgtccagcctggcgcgcaaatcagccccacc
acgccgctgatggccgtggtgcctgcaaccgatctgtgggtggacgctaactttaaagaa
acccaattagcgaatatgcgcattgggcagccagtgacggtgattactgatatttatggc
gacgacgtaaaatacaccggtaaagtcgtcggtctggatatgggaacaggcagcgccttc
tccctgctgcccgcgcaaaatgcgacgggtaactggattaaagtggttcaacgtctgccg
gtacgcgtcgaactggacgcccgccagttagaacaacatccgctgcgcattggtttatcg
acgctggtcaccgtggataccgctaatcgcgacggtcaggtactggccagccaggtacga
acgacgccggttgccgaaagtaacgcacgcgaaattaatctcgcgccggtcaataaactg
atcgacgacatcgtacaggctaacgcgggttaa

DBGET integrated database retrieval system