KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_03749
Entry
SU5_03749         CDS       T02011                                 

Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00052  Galactose metabolism
shb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SU5_03749
Enzymes [BR:shb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SU5_03749
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 MTS ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 Methyltransf_11 3HCDH_N PrmA Shikimate_DH UDPG_MGDP_dh_N Met_10 Pyr_redox_2 Sacchrp_dh_NADP Methyltransf_24 CoA_binding ELFV_dehydrog Pyr_redox FAD_binding_2 Fer4_4
Other DBs
NCBI-ProteinID: AFH47072
LinkDB
Position
4105142..4106185
AA seq 347 aa
MKSVVIHAEGDVCVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQLVLETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLAPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgtgcgttgaagaacgtcccttacca
caactgcaagccgaggacgatgtgttggtcaaagtcgttagctcagggctttgcgggtcg
gatatcccgcgtattttcgcgcagggcgcccattattatcctattacgttaggccatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcctggcgatgcc
gtcgcttgtgtcccgcttcttccctgctttcactgtccgcaatgcgaacgcggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgcagcgaaggcggtaatgcggaatat
gtggtggtcaaacgggccaatcttttccgcttgccgtctgatatgccgattgaagatggc
gcgtttatcgaaccgattaccgtgggattacacgcctttcatctggcgcagggctgcgag
gggaaaaacgtaattatcgtcggtgcggggacaattggcctgctggccttacagtgcgcg
cgggaactgggcgcgcgaagcgtaacggcgattgatatcaatccgcagaaactggaactg
gcgaaagcgctcggcgcaacgcatacctgtaatagccgggaaatgaccgccgacgacatc
caaaccgcgttgtctgacattcagtttgatcaactggttctcgaaacggcaggaactccc
cagaccgtctcgctggctatcgatatcgccgggccgcgcgcgcaactggcgctggtgggg
acgttacatcacgatctcaccctgacaacgcgtacattcgggttaattttgcgtaaagag
ctcacgctcctcggcagttggatgaactactccgcgccatggccaggagaggaatgggaa
accgcagcgcgcctgttggctgaaaaacgtcttcaactggcccctctcattgcccatcgc
ggcgatgcggaaagctttgcagaagcagtcaaagcgcttaatggcgcgcccatgcagggc
aaaattttacttcaactttcctga

DBGET integrated database retrieval system