KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0756Help
Entry
SU5_0756          CDS       T02011                                 

Definition
(GenBank) Cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00550  Peptidoglycan biosynthesis
shb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:shb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SU5_0756
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    SU5_0756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shb01011]
    SU5_0756
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shb03036]
    SU5_0756
Enzymes [BR:shb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SU5_0756
Peptidoglycan biosynthesis and degradation proteins [BR:shb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SU5_0756
Chromosome and associated proteins [BR:shb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    SU5_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AFH44127
LinkDB All DBs
Position
871593..873359
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWLQIIAPDMLVRQGDMR
SLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALSTALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDAMRNRTIT
DVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERIFPESTVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcaaaaacgcaaaaatcgaaacgccaggaagaacagaccaacttcatc
agttggcgttttgcgttgctgtgcggctgtattttactggcgctggtttttttacttgga
cgcgcggcgtggctacagattatcgccccggatatgctggtgcgtcagggcgatatgcgt
tcgctgcgtgttcaggaagtctccacctcacgcggtatgattaccgaccgttccgggcgt
ccactggcggtcagcgtaccggttaaggcgatctgggccgacccgaaagaagttcatgac
gccggcggcatcagcgttggcgatcgctggaaagcgctttctactgcgctcaatattccg
ctcgatcagctctccgcccgtatcaacgccaacccgaaagggcgttttatttatctggcg
cgccaggtaaatcctgacatggcggactacatcaaaaaactcaaactgccggggattcat
ttgcgtgaagaatcacgccgctactacccgtcaggagaagtaaccgctcacctcatcggt
tttaccaacgtcgacagtcaggggattgaaggcgttgaaaagagctttgataagtggctt
accggtcagcctggcgagcgaatcgtgcgtaaagaccgctatggccgcgtgattgaggat
atctcctccactgacagtcaggcagcgcacaacctggcgttaagcattgatgaacgctta
caggcgctggtttaccgcgaactgaacaacgcggtggcgtttaacaaggcggaatccggt
agcgcggtgctggtcgatgtcaataccggtgaagtactggcgatggcgaatagcccttcc
tataaccccaacaaccttgccggtacgccgaaagacgcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccgggttctacggttaagccgatggtggtgatgactgcgcttcagcgc
ggtatcgtcaacgaaaatacggtgttgaataccgttccataccgaattaacggccacgaa
attaaagacgtggcgcgctacagcgaattaaccctgaccggggttctacagaagtcgagt
aacgtcggtgtatccaaactggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttgggctaggaaaggcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtccgacatagagagggccaccttctctttcggctacggg
ctaatggtaacgccgttacagttagcgcgagtctatgcaacgatcggcagctatggcatt
tatcgcccgctgtcgattaccaaagttgatccgcctgtacccggcgaacgcatcttccct
gaatccaccgtacgcactgtggtgcatatgatggaaagcgtggcgctgccgggcggcggc
ggcgtgaaggcggcaattaaaggctaccgtatcgcgattaaaaccggtacggcgaaaaaa
gtggggccggacggtcgctacatcaacaaatacattgcttacaccgcaggcgtcgcgcct
gcgagtcagccgcgcttcgcgctggtggttgtcatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtatttggtgccatcatgggcggcgttctgcgcacc
atgaacatcgaaccggacgcgctggcaacgggcgaaaaaaatgaattcgtaattaatcaa
ggcgagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system