KEGG   Staphylothermus hellenicus: Shell_0125Help
Entry
Shell_0125        CDS       T01249                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00030  Pentose phosphate pathway
shc01100  Metabolic pathways
shc01120  Microbial metabolism in diverse environments
shc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shell_0125
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Shell_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADI31269
UniProt: D7DAS2
LinkDB All DBs
Position
complement(107856..109733)
Genome map
AA seq 625 aa AA seqDB search
MGRILRVNLWRNKYYIEPLPPETVLRSWLGGRGLGVYLALKEIDPKADPLGPRNKAFVMT
GPITGVAGIPEAGRWCSVTKSPLTDTIHDSQSGGKFGPELKFAGFDAIILEDISEKPVYL
WIHDGKVEIRDATHLWGKDVHSTTDIIQEELAAEIGRDEAKKVKVLAIGPAGENLVRFAA
LMNDKYRAAGRGGHGAVWGSKKIKAIAVRGHMKPEIAKKEMFKEVVIKMVKKHRENPVTS
EGLPKLGTAILVNIINKAGMLPTRNFRTGVFEGAEKISGEVLAEKYLDKKKSVEESCWGC
VITCGRYTKVGKSPFSGEGGGPEYETIWAFGAQTGTDDLEAINKANYLCNELGLDTISMG
NTIGALMELVELGKIPPEKLRGLNVKWGSPDAIVELVWRTAYRSGIGDELAEGSWRLAQK
YGAPEVSMSVRGQELPAYDPRGAQGQGLAYATSNRGGCHVRAYLISPEVLGVPKLVDRFT
TKGKPALVKEFQDVTAVVDSMIVCLFSSFAIWDEDYAEIISAVTGWDVSKDEVHKIGERI
YNAERAFNVLSFGDGREYDTLPKRLLEEPMPEGPSKGHVVRLNEMLDEYYKLRGWIDGRP
TRAKLEELGLKWVADRLEEEGLLPG
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaatcctacgtgtcaacttatggagaaataaatactatattgagccattgcct
ccagagactgttcttagaagctggctgggtggaagaggattaggcgtttaccttgcgttg
aaagaaattgatccaaaagctgatccccttggtccaaggaataaagcatttgttatgaca
ggccctataacaggtgttgcaggcataccagaagctggtagatggtgtagtgtaacaaag
tctccattaacagatacaatacatgattctcagagcggtggaaagtttgggcctgaacta
aagtttgcagggttcgatgctattatattagaggatattagcgagaaaccagtgtatcta
tggatacatgatggcaaagtcgagattagagacgctacccatttatggggcaaggatgtg
cattcaactactgatattatccaggaagaacttgcagccgagatcggtagggatgaggct
aagaaggtaaaagtattagcaatagggcccgctggagaaaaccttgtaagatttgctgca
ttaatgaatgataagtacagagctgccggccgaggaggccatggagctgtatggggtagt
aagaagattaaagcaatagctgtacgcggccacatgaagccagagattgctaagaaggag
atgtttaaggaagtagttattaagatggttaagaagcatcgtgaaaacccggttacttcg
gaggggctgcctaagctgggtacagcgatactggtaaacattatcaataaggcaggcatg
ctcccgacaaggaacttccgtacaggtgtatttgagggtgcggaaaagattagcggcgaa
gtattagctgagaagtatcttgataagaaaaagagtgttgaagaatcatgttggggctgt
gtaatcacttgtggaagatatactaaggtaggaaaatccccatttagtggggagggagga
ggcccagagtatgagacgatctgggcctttggcgcgcaaacaggcacagacgatctggaa
gctattaacaaggctaactatctatgtaatgagctagggcttgacactataagtatgggc
aatactattggtgcgttgatggagcttgtagagctaggcaagattcctccagagaagctt
cgcggactaaatgttaaatggggctcgccagatgctatagttgagcttgtatggagaaca
gcgtataggagcggtataggcgatgagctagctgagggttcttggagattagcacaaaaa
tatggtgcaccagaagtatcgatgagtgtgagaggacaggagctgccagcatatgatcca
agaggggcacagggccaaggtttagcatatgctacaagtaatcgtggaggatgccacgta
agagcatacctgatatcacctgaggtcctcggtgtaccaaaacttgtggacaggtttaca
accaagggcaagcccgctcttgtcaaggagttccaagatgtcaccgccgtagtagactct
atgatcgtatgtttgttctcaagcttcgccatatgggatgaagactatgctgaaataata
agtgctgtaacaggctgggatgtctccaaggatgaagtacacaagatcggtgagagaata
tacaatgctgaaagagcatttaacgtactaagctttggcgatggaagagaatatgataca
ctgccgaagagacttctcgaagaaccaatgccggagggaccatcaaaaggacacgttgtc
aggctaaacgagatgctagacgaatactataagctaagaggatggatagatggaagacca
acaagagcaaaactggaagaactaggtcttaaatgggtagcagacagactagaagaagaa
ggactattacctggctaa

DBGET integrated database retrieval system