KEGG   Sulfuritalea hydrogenivorans: SUTH_00234Help
Entry
SUTH_00234        CDS       T03591                                 

Definition
(GenBank) rod shape-determining protein MreC
  KO
K03570  rod shape-determining protein MreC
Organism
shd  Sulfuritalea hydrogenivorans
Brite
KEGG Orthology (KO) [BR:shd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shd03036]
    SUTH_00234
Chromosome and associated proteins [BR:shd03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SUTH_00234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreC
Motif
Other DBs
NCBI-ProteinID: BAO28051
UniProt: W0SAM0
LinkDB All DBs
Position
236383..237303
Genome map
AA seq 306 aa AA seqDB search
MSVVGHAPPPFFKRGPAPLVRLAFFVSLSLILLVADLRFHTLEWARLAVATVAWPLQRIT
WMPIDAAGDAGGYLTRQSTLLKENEELRRRQLGTANLLLRQQHLETENMRLRALLDMRAR
QPVEGRIAEILYAARDPFSRRVIIDKGIQHGISAGQAVVDDIGVIGQVARVFPLTSEVLL
LTDKDQAIPVEVQRNGLRAVLAGAGAGMMELRFLAANAEIQVGDILVTSGLDGVYLPGLP
VAKVARIDRDSAYSFARITCAPLAGVERHGLALVLGARTALPPQPDDLPATADKPAAGKR
VKKKAR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgttggccatgctccgccaccctttttcaaacggggtccggcgccgctcgtg
cggctggctttcttcgtctcgctttcgctgatcctgctggtggccgacctgcgcttccac
actttggaatgggcgcggctggcggttgccacggtggcctggcccctgcagcgcatcacc
tggatgccgatcgatgccgccggcgatgccggcggctatctgacgcggcaatccacgctg
ctgaaggaaaacgaggaactgcgccggcgccagctcggcaccgccaatctcctgctgcgc
cagcagcacctggaaaccgaaaacatgcggctgcgcgccctgctcgacatgcgcgcgagg
cagccggtcgaagggcgcatcgccgagattctctacgcggcgcgcgatccgttttcgcgg
cgggtgatcatcgacaagggcatccagcacggcatcagcgccggccaggcagtggtcgat
gacatcggcgtgatcggccaggtggcgcgggttttcccgctcacctcggaagtactgctg
ttgaccgacaaggatcaggcgattccggtcgaggtgcagaggaacggcttgcgcgccgtg
ctggcgggcgccggggcgggcatgatggaactgcgcttcctcgcggcgaacgccgagatc
caggtcggcgacatcctggtgacgtcgggactcgacggcgtctacctgcccggcttgccg
gtggccaaagtggccaggatcgaccgcgacagcgcctattcgtttgcccgtatcacctgt
gcgccgctggccggcgtcgaacgtcacggcctggcgctggtgctgggtgcccgcacggcc
ctgccgccgcagccggacgatctgccggcgacagccgacaagcccgccgccggcaagcgg
gtcaagaagaaggccagatga

DBGET integrated database retrieval system