KEGG   Sulfuritalea hydrogenivorans: SUTH_00271Help
Entry
SUTH_00271        CDS       T03591                                 

Definition
(GenBank) RNA methylase
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
shd  Sulfuritalea hydrogenivorans
Brite
KEGG Orthology (KO) [BR:shd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SUTH_00271
Enzymes [BR:shd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SUTH_00271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP N6_Mtase MTS
Motif
Other DBs
NCBI-ProteinID: BAO28087
UniProt: W0SB21
LinkDB All DBs
Position
complement(275055..276230)
Genome map
AA seq 391 aa AA seqDB search
MNHYFTTCPRGLEALLAEDLAAAGGKDIATVPGGVGCNGSTETGYRINLESRIATRVLWR
VARGGYRSEAEVYQLAYDVDWSKLFSVDRSIRVYVTAIRSPLKSIEFITLKVKDAVCDRF
RAETGRRPSVNTKHPEVRIHLFVTEQQATLYLDTSGEPLYMRGHKLAKVGAPLKENLAAG
ILRLSGWQPGTPLLDPMCGSGTFLLEAAQMCLDDAPGLSREPGDFGFEHLKSFDAGLWRK
LQREAAERRREATALPLFGSDIAADAVARTRQNLAGAGLDDLVTLQQADLLTRPAPAPAG
VMVANPPYGERLGSEEELAAFYPKLGDALKQRFAGWSCWFLSADTQLPKLIRLQTSRKIP
LYNGALECRLYNIQIVAGSLRRNALTGDSAS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactatttcaccacctgcccgcgcgggctcgaggcgctgcttgccgaagacctc
gccgccgccggcggcaaggacattgccaccgtgccgggcggcgtcggctgcaacggcagc
actgaaaccggctaccgcatcaacctcgaatcgcgcattgcgacgcgggtcttgtggcgc
gtcgcgcgcggcggctatcgcagcgaagccgaggtctatcaactggcctacgacgtcgac
tggtcgaagctgttctccgtcgatcgctcgattcgcgtctatgtcacggcgatccgttcg
ccgctgaagagcatcgagttcatcacgctgaaggtcaaggacgcggtctgcgaccgcttc
cgcgccgaaaccggacggcggcccagcgtcaatacgaagcacccggaagtgcgcatccac
ctgttcgtcaccgagcagcaggccacgctctatctcgacacctccggcgaaccgctctac
atgcgcggccacaagctggccaaggtcggcgcgccgctcaaggaaaaccttgccgccggc
atcctgcgcctttccggctggcagccgggcacaccgttgctcgatccgatgtgcggcagc
ggcaccttcctgctcgaagcggcgcagatgtgcctcgacgacgcgccggggctgtcacgc
gaaccgggcgacttcggcttcgagcatctcaaatccttcgatgccggcctctggcgcaag
ctgcagcgcgaagccgcagagcgccgccgcgaggcgacggccttgccgctgttcggcagc
gacattgccgccgatgcggtcgcccgcacgcggcagaatctggccggggccgggctcgac
gatctggtcacgctgcagcaggccgatctgctgacacgcccggcgccggcaccagcgggc
gtcatggtggccaatccgccctatggcgaacggctcggcagcgaagaggaactggcggcc
ttctatccgaaactgggcgatgccctcaagcagcgcttcgccggctggagctgctggttc
ctctccgccgacacgcaactgcccaaactgatccggttgcagacctcgcgcaagatcccg
ctctacaacggcgcgctcgaatgccgcctgtacaatattcaaattgtcgccggatcattg
cggcgcaatgctcttacaggagattctgcatcttga

DBGET integrated database retrieval system