KEGG   Sulfuritalea hydrogenivorans: SUTH_00860Help
Entry
SUTH_00860        CDS       T03591                                 

Gene name
ahpF-1
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shd  Sulfuritalea hydrogenivorans
Brite
KEGG Orthology (KO) [BR:shd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SUTH_00860 (ahpF-1)
Enzymes [BR:shd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SUTH_00860 (ahpF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO NAD_binding_8 FAD_binding_3 AlaDh_PNT_C K_oxygenase Glutaredoxin Thi4 FMO-like NAD_binding_9 Adeno_PIX WhiA_N
Motif
Other DBs
NCBI-ProteinID: BAO28667
UniProt: W0SCK7
LinkDB All DBs
Position
complement(869427..871031)
Genome map
AA seq 534 aa AA seqDB search
MLDAAIKTQLSAYLEKLQTPIELVASLDASDAARQMRELLADIAALSPKVSVREDGTDAR
KPSFSVGRPNEAARIRFAGIPMGHEFTSLVLALLQTGGHPPKVDAAVTEQIKGLSGKFRF
ETYISLSCHNCPDVVQALNLMAVLNPGVESVMIDGALYQDEVSARKIMAVPTVMLNGEPF
GQGRMTIEEILARVDTGASARDAEKLNAKDAYDVLVVGGGPAGSAAAIYAARKGIRTGVV
AERFGGQVLDTLSIENLISVPHTEGPKLAMALEQHVKQYEVDIMNLQRAEALIPAGDDGL
AQVRLANGATLKAKSVILATGARWREMNVPGEKEYKARGVCFCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQAKLGSLPNVTIVTSALTTEVTGDGE
KVNGIVFQDRIGGQTKRVELEGIFVQIGLLPNTDWLKGTVNLSPRGEIEIDARGQTSLPG
VFAAGDATTTPYKQIIIAMGEGAKASLSAFDHLIRSPAPAPAATKSGVDLGQPA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccgcgatcaagacccagctttccgcctatctcgaaaagctccagacgccc
atcgaactcgtcgcctcgctcgacgccagcgatgccgcgcgccagatgcgcgagctgctg
gccgacatcgccgcgctctcgcccaaggtcagcgtgcgcgaagacggcacagatgcccgc
aagccgtccttctccgtcggccgcccgaatgaggccgcgcgcatccgcttcgccggaatc
ccgatgggccacgaattcacttcattggtgctcgcgctgttgcagaccggcggccacccg
cccaaggtggatgccgccgtgaccgagcagatcaagggtctcagtggcaagtttcgcttc
gaaacctacatctcgctctcctgccacaactgcccggacgtggtgcaggcactcaacctg
atggccgtgctcaaccccggcgtcgagagcgtgatgatcgacggcgccttgtatcaggac
gaagtgagcgcacgcaaaatcatggccgtgccgaccgtgatgctgaatggcgagcccttc
ggccagggccgcatgaccatcgaggaaatcctcgccagggtggataccggcgcttctgcc
cgcgatgccgagaagctgaacgccaaagacgcctacgacgtcctcgtcgtcggcggtggc
ccggccggttcggcggcggcgatctacgccgcgcgcaagggcatccgcaccggcgtggtg
gccgagcgcttcggcggccaggtgctcgacaccctgtcgatcgagaacctgatctcggtg
ccgcataccgaagggccgaagctcgccatggcgctggaacagcacgtcaagcagtacgag
gtcgacatcatgaatttgcagcgcgccgaggccttgatcccggccggcgatgacggactg
gcccaggtcaggctcgccaacggcgccacgctgaaagcaaagagcgtgatcctcgccacc
ggcgcgcgctggcgcgaaatgaacgtgcccggcgaaaaggaatacaaggccaggggcgtc
tgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaactcgggagtcgaggcggcgattgacctcgccggcatcgtcagccatgtcacg
ctgctcgaattcgacagcaagctgcgcgccgacgccgtgttgcaggccaagctcggcagc
ctgcccaatgtcaccatcgtcaccagtgcgctgaccaccgaggtcaccggcgacggcgag
aaggtgaatggcatcgtgtttcaggatcgcatcggcggacagaccaagcgggtcgagctc
gaaggcatcttcgtccagatcggcctgctgcccaacacggattggctgaagggcaccgtg
aacctctcaccgcgcggcgagatcgagatcgatgcgcgcggccagacttcgctgcccggc
gtcttcgccgccggcgacgcgacgaccacgccctacaagcagatcatcatcgccatgggt
gaaggcgccaaggcatcgctctccgcgttcgatcacctgatccgcagtccggcgcccgcg
ccggccgcgacgaaatctggcgttgatctgggtcaacctgcctga

DBGET integrated database retrieval system