KEGG   Sulfuritalea hydrogenivorans: SUTH_02005Help
Entry
SUTH_02005        CDS       T03591                                 

Definition
(GenBank) protein kinase:GAF
Organism
shd  Sulfuritalea hydrogenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase HDOD Pkinase_Tyr APH GAF Kdo GAF_3 RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: BAO29796
UniProt: W0SFJ6
LinkDB All DBs
Position
complement(2048396..2050813)
Genome map
AA seq 805 aa AA seqDB search
MEKCIGRFEIRRELGRGAQSIVYLGWDPQLEREVAIKTLHFARADAKRNEALLAEARSVS
RLRHPNLVPIFDAGEEDGDPYLVFEFVDGPNLAELIAREGRIAPARTADLMRQVLDALAL
AHAAGIIHRDLKPSNILIDAQGRPRVMDFGIARRLDAIDVEKEHVGITGTLGYLAPEYVD
GRQVSEKSDVYAAGLVMIEMLSGTPWVKGGTSVSMIHQILSQPVTLPADVSIDNQLAGIV
LKACARDPALRTDSAAQMKSQLDDYLGAAATPIDTTETEASAEARKRDTLNFLIRRMKHK
TDFPALSDSVSAINRLTRSDKESINRLSNTILKDYGLTNKILRLVNSVHYRRSGGGTIST
ISRAVIVLGFDALRNIAITVLLFEHMQDKGSARELKEAFLRANLAGCLARDAAREFMARD
AEEAYVCALFHSVGQLLAQFYFPEEVAEVRKVMLQKNCTDEIASTQIFGLSFSELGLGIA
RHWGFPQGIINSLRPLPEGLVKKPTTHDETLRVVAGFANEICASIASVPKEQRTQATNAA
RQRFNAAMSFSDSQLQNVLEKSFAELKELAAVLHVNLTQSPFVRHVKEWTGARQETPPAA
EEAATASALELTVLGDPELRDQSETGEVNAEGVPDAAQDILAAGIQDISNSLVDDFSLND
VLRITLETMYRAMGFERVLLCLREPKTASMVGRFGFGADTSEVARKFRFPLEDAPNVFQL
AISKGVDIIITDIDDPKIAGKIPDWYRKTVIAKTFVLLPLLIKGKAVGLIYCDRDRAGGI
VIPEKELSLMKTLRNQALLAIKQSM
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatgtatcggccgctttgaaatccgtcgagaactcggacgcggcgctcaaagc
atcgtctatcttggatgggatccgcaactggaacgcgaagtggcgatcaagacgctgcat
ttcgcgcgcgccgatgccaaacgcaatgaagccctgctggccgaggcgcgctctgtcagc
cgcttgcgacaccccaatctggtgccgattttcgacgccggcgaggaggatggcgatccc
tatctcgtgttcgagtttgtcgatggcccgaacctcgccgagctgatcgccagggaaggc
cgcatcgctcccgcgcgtaccgccgatctgatgcgccaggtgctcgatgcgctggcactg
gcccatgcggcggggatcatccaccgcgacctgaagccctccaacatcctgatcgatgcc
cagggacgcccgcgtgtaatggatttcggcatcgccaggcgcctcgatgcgatcgatgtc
gaaaaagaacatgtgggcattaccggtaccctcggctatctcgcgcccgagtatgtcgat
ggccgccaggtcagcgaaaaatcagacgtctacgccgccggactggtcatgatcgagatg
ctgtccggtacaccgtgggtaaagggcggcacgtcggtcagcatgattcatcaaatactg
agccagccggtgacgctgcccgccgatgtcagcatcgacaatcaactggccggcatcgtt
ctgaaggcctgcgcgcgcgatccggccttgcgcacggacagcgcggcgcagatgaagtcg
cagcttgacgattaccttggcgccgccgccacgcccatcgacacgaccgagacagaggct
tcggccgaggcccgaaagcgcgacacgctgaacttcctgatccgccgcatgaaacacaaa
acggactttccggcgctctcggattcggtgtcggcgatcaaccggctgacgcgctccgac
aaggagagcatcaacaggctttccaataccattctcaaggactacggcctgaccaacaag
attctgcgcctggtgaactcggtgcattaccggcgctcgggcggcggcaccatcagcacc
atttcgcgcgccgtgatcgtgctgggtttcgatgccttgcgcaacatcgccattacggtg
ctgctgttcgagcacatgcaggacaagggcagcgcgcgcgaactgaaggaagccttcttg
cgcgccaatctggcgggctgcctggcgcgggatgccgccagggaattcatggcgcgggat
gcggaagaagcctatgtctgcgccttgtttcatagcgttggccagcttctggcgcagttt
tattttccggaagaagtggccgaagttcgaaaagtcatgctgcaaaagaactgcaccgac
gaaatcgcctcgacccagattttcggcctgtcattctcggaactgggacttggcattgca
cgtcactggggctttccgcaggggatcatcaacagcctgcggcccttgccggagggattg
gtcaaaaagcccacgacacatgacgagacgctgcgggttgtggccggtttcgccaacgaa
atctgtgcctcgatcgcatcggtaccgaaggagcagagaacccaggcgacgaatgcggcg
cgtcagcgtttcaatgccgccatgtccttttccgacagccagttgcagaacgtgctggaa
aagtcgtttgcggaactcaaggaactggcagccgttctccatgtgaatctgacgcaaagc
ccttttgttcgccatgtcaaggagtggaccggagcacgccaggaaacgccacccgcggca
gaagaagcggcgaccgcatcggcgctggaactgaccgtgctcggcgacccggagttgcgc
gatcagagcgaaaccggcgaggtgaatgccgagggcgttcccgatgcggcacaggatatt
ctcgcggccggaatccaggacatcagcaactcgctggtggacgatttttcattgaatgac
gtgctgcgcattacgctggagaccatgtatcgggcgatgggattcgagcgcgtgctgctg
tgcctcagggaacccaagaccgccagcatggtggggcgtttcggctttggcgccgacacc
agcgaggtggcgcgaaaattccgctttccgctggaggacgcgccaaacgtgtttcaactg
gcgatcagcaagggagtggacatcatcatcaccgatatcgatgatcccaagattgccggc
aagattcccgactggtatcgcaagaccgtgatcgccaaaaccttcgttctgctgccgctg
ctgatcaagggcaaggcagtcgggctgatctactgcgatcgcgacagggctggcggcatc
gtcatccccgaaaaggaattgtcgctgatgaagaccctgcgcaaccaggcgcttctggcc
atcaagcaatccatgtag

DBGET integrated database retrieval system