KEGG   Sulfuritalea hydrogenivorans: SUTH_02005
Entry
SUTH_02005        CDS       T03591                                 

Definition
(GenBank) protein kinase:GAF
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shd  Sulfuritalea hydrogenivorans
Brite
KEGG Orthology (KO) [BR:shd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shd01001]
    SUTH_02005
Enzymes [BR:shd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SUTH_02005
Protein kinases [BR:shd01001]
 Serine/threonine kinases: Other
  Bacterial family
   SUTH_02005
SSDB
Motif
Pfam: Pkinase HDOD PK_Tyr_Ser-Thr APH GAF Kdo Pkinase_fungal GAF_3 RIO1
Other DBs
NCBI-ProteinID: BAO29796
UniProt: W0SFJ6
LinkDB
Position
complement(2048396..2050813)
AA seq 805 aa
MEKCIGRFEIRRELGRGAQSIVYLGWDPQLEREVAIKTLHFARADAKRNEALLAEARSVS
RLRHPNLVPIFDAGEEDGDPYLVFEFVDGPNLAELIAREGRIAPARTADLMRQVLDALAL
AHAAGIIHRDLKPSNILIDAQGRPRVMDFGIARRLDAIDVEKEHVGITGTLGYLAPEYVD
GRQVSEKSDVYAAGLVMIEMLSGTPWVKGGTSVSMIHQILSQPVTLPADVSIDNQLAGIV
LKACARDPALRTDSAAQMKSQLDDYLGAAATPIDTTETEASAEARKRDTLNFLIRRMKHK
TDFPALSDSVSAINRLTRSDKESINRLSNTILKDYGLTNKILRLVNSVHYRRSGGGTIST
ISRAVIVLGFDALRNIAITVLLFEHMQDKGSARELKEAFLRANLAGCLARDAAREFMARD
AEEAYVCALFHSVGQLLAQFYFPEEVAEVRKVMLQKNCTDEIASTQIFGLSFSELGLGIA
RHWGFPQGIINSLRPLPEGLVKKPTTHDETLRVVAGFANEICASIASVPKEQRTQATNAA
RQRFNAAMSFSDSQLQNVLEKSFAELKELAAVLHVNLTQSPFVRHVKEWTGARQETPPAA
EEAATASALELTVLGDPELRDQSETGEVNAEGVPDAAQDILAAGIQDISNSLVDDFSLND
VLRITLETMYRAMGFERVLLCLREPKTASMVGRFGFGADTSEVARKFRFPLEDAPNVFQL
AISKGVDIIITDIDDPKIAGKIPDWYRKTVIAKTFVLLPLLIKGKAVGLIYCDRDRAGGI
VIPEKELSLMKTLRNQALLAIKQSM
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggaaaaatgtatcggccgctttgaaatccgtcgagaactcggacgcggcgctcaaagc
atcgtctatcttggatgggatccgcaactggaacgcgaagtggcgatcaagacgctgcat
ttcgcgcgcgccgatgccaaacgcaatgaagccctgctggccgaggcgcgctctgtcagc
cgcttgcgacaccccaatctggtgccgattttcgacgccggcgaggaggatggcgatccc
tatctcgtgttcgagtttgtcgatggcccgaacctcgccgagctgatcgccagggaaggc
cgcatcgctcccgcgcgtaccgccgatctgatgcgccaggtgctcgatgcgctggcactg
gcccatgcggcggggatcatccaccgcgacctgaagccctccaacatcctgatcgatgcc
cagggacgcccgcgtgtaatggatttcggcatcgccaggcgcctcgatgcgatcgatgtc
gaaaaagaacatgtgggcattaccggtaccctcggctatctcgcgcccgagtatgtcgat
ggccgccaggtcagcgaaaaatcagacgtctacgccgccggactggtcatgatcgagatg
ctgtccggtacaccgtgggtaaagggcggcacgtcggtcagcatgattcatcaaatactg
agccagccggtgacgctgcccgccgatgtcagcatcgacaatcaactggccggcatcgtt
ctgaaggcctgcgcgcgcgatccggccttgcgcacggacagcgcggcgcagatgaagtcg
cagcttgacgattaccttggcgccgccgccacgcccatcgacacgaccgagacagaggct
tcggccgaggcccgaaagcgcgacacgctgaacttcctgatccgccgcatgaaacacaaa
acggactttccggcgctctcggattcggtgtcggcgatcaaccggctgacgcgctccgac
aaggagagcatcaacaggctttccaataccattctcaaggactacggcctgaccaacaag
attctgcgcctggtgaactcggtgcattaccggcgctcgggcggcggcaccatcagcacc
atttcgcgcgccgtgatcgtgctgggtttcgatgccttgcgcaacatcgccattacggtg
ctgctgttcgagcacatgcaggacaagggcagcgcgcgcgaactgaaggaagccttcttg
cgcgccaatctggcgggctgcctggcgcgggatgccgccagggaattcatggcgcgggat
gcggaagaagcctatgtctgcgccttgtttcatagcgttggccagcttctggcgcagttt
tattttccggaagaagtggccgaagttcgaaaagtcatgctgcaaaagaactgcaccgac
gaaatcgcctcgacccagattttcggcctgtcattctcggaactgggacttggcattgca
cgtcactggggctttccgcaggggatcatcaacagcctgcggcccttgccggagggattg
gtcaaaaagcccacgacacatgacgagacgctgcgggttgtggccggtttcgccaacgaa
atctgtgcctcgatcgcatcggtaccgaaggagcagagaacccaggcgacgaatgcggcg
cgtcagcgtttcaatgccgccatgtccttttccgacagccagttgcagaacgtgctggaa
aagtcgtttgcggaactcaaggaactggcagccgttctccatgtgaatctgacgcaaagc
ccttttgttcgccatgtcaaggagtggaccggagcacgccaggaaacgccacccgcggca
gaagaagcggcgaccgcatcggcgctggaactgaccgtgctcggcgacccggagttgcgc
gatcagagcgaaaccggcgaggtgaatgccgagggcgttcccgatgcggcacaggatatt
ctcgcggccggaatccaggacatcagcaactcgctggtggacgatttttcattgaatgac
gtgctgcgcattacgctggagaccatgtatcgggcgatgggattcgagcgcgtgctgctg
tgcctcagggaacccaagaccgccagcatggtggggcgtttcggctttggcgccgacacc
agcgaggtggcgcgaaaattccgctttccgctggaggacgcgccaaacgtgtttcaactg
gcgatcagcaagggagtggacatcatcatcaccgatatcgatgatcccaagattgccggc
aagattcccgactggtatcgcaagaccgtgatcgccaaaaccttcgttctgctgccgctg
ctgatcaagggcaaggcagtcgggctgatctactgcgatcgcgacagggctggcggcatc
gtcatccccgaaaaggaattgtcgctgatgaagaccctgcgcaaccaggcgcttctggcc
atcaagcaatccatgtag

DBGET integrated database retrieval system